Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human VDAC2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P45880
Molecular weight:
30.11 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Gly36–Ala294
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human VDAC2 Protein, N-His

Product name ARO-P12363-100
Uniprot ID P45880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Molecular weight 30.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly36-Ala294
Aliases /Synonyms Outer mitochondrial membrane protein porin 2, Voltage-dependent anion-selective channel protein 2, VDAC2, hVDAC2, VDAC-2
Reference ARO-P12363
Note For research use only.
Molecular Constructor
Gly36–Ala294
Product name ARO-P12363-1MG
Uniprot ID P45880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Molecular weight 30.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly36-Ala294
Aliases /Synonyms Outer mitochondrial membrane protein porin 2, Voltage-dependent anion-selective channel protein 2, VDAC2, hVDAC2, VDAC-2
Reference ARO-P12363
Note For research use only.
Molecular Constructor
Gly36–Ala294
Product name ARO-P12363-50
Uniprot ID P45880
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
Molecular weight 30.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly36-Ala294
Aliases /Synonyms Outer mitochondrial membrane protein porin 2, Voltage-dependent anion-selective channel protein 2, VDAC2, hVDAC2, VDAC-2
Reference ARO-P12363
Note For research use only.
Molecular Constructor
Gly36–Ala294

Introduction

Recombinant Human VDAC2 (voltage-dependent anion channel 2) protein is a key player in the transport of metabolites and ions across the mitochondrial outer membrane. This protein is encoded by the VDAC2 gene and is expressed in various tissues, including the brain, heart, and skeletal muscle. Recombinant Human VDAC2 protein has been extensively studied for its structure, activity, and potential applications in various fields.

Structure of Recombinant Human VDAC2 Protein

Recombinant Human VDAC2 protein is a transmembrane protein that consists of 282 amino acids with a molecular weight of approximately 31 kDa. It is composed of three domains: the N-terminal domain, the central transmembrane domain, and the C-terminal domain. The N-terminal domain has a helical structure, while the transmembrane domain contains a beta-barrel structure with 19 beta-strands. The C-terminal domain is less structured and contains a flexible loop region.

Activity of Recombinant Human VDAC2 Protein

Recombinant Human VDAC2 protein is a highly active channel that plays a crucial role in the transport of metabolites and ions across the mitochondrial outer membrane. It acts as a gatekeeper, regulating the flow of molecules into and out of the mitochondria. This protein has been shown to transport a wide range of metabolites, including ATP, ADP, NADH, and pyruvate, as well as ions such as Ca2+, K+, and Cl-. Its activity is regulated by changes in membrane potential and the presence of various ligands.

Application of Recombinant Human VDAC2 Protein

Recombinant Human VDAC2 protein has been extensively studied for its potential applications in various fields, including medicine, biotechnology, and bioenergy.

Medicine

Recombinant Human VDAC2 protein has been implicated in various diseases, including cancer, neurodegenerative disorders, and metabolic disorders. Its role in regulating cell metabolism and apoptosis has made it a potential target for therapeutic interventions. Studies have shown that modulating the activity of VDAC2 can have a significant impact on the progression of diseases, making it a promising target for drug development.

Biotechnology

Recombinant Human VDAC2 protein has been used in biotechnology for its ability to transport molecules across the mitochondrial outer membrane. This protein has been incorporated into artificial lipid bilayers to create synthetic channels for the transport of metabolites and ions. It has also been used in the development of biosensors for the detection of various molecules, including glucose and lactate.

Bioenergy

Recombinant Human VDAC2 protein has been studied for its potential use in bioenergy production. Its ability to transport metabolites and ions across the mitochondrial outer membrane has been harnessed to develop biofuel cells. These cells use VDAC2 to generate electricity from the breakdown of glucose, making it a promising candidate for sustainable energy production.

Conclusion

Recombinant Human VDAC2 protein is a highly active channel that plays a crucial role in the transport of metabolites and ions across the mitochondrial outer membrane. Its structure, activity, and potential applications have been extensively studied, making it a promising target for therapeutic interventions, biotechnology, and bioenergy production. Further research on this protein could lead to significant advancements in various fields and improve our understanding of its role in health and disease.

Recombinant Human VDAC2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human VDAC2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products