Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ZNF671 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TAW3
Molecular weight:
31.92 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Met280–Leu534
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ZNF671 Protein, N-His

Product name ARO-P11384-100
Uniprot ID Q8TAW3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGQRYHRCGECGKAFTRKDTLARHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFFRQISGLIEHRRVHTGERLYQCGKCGKFFSSKSNLIRHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHTGERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYECSKCGKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL
Molecular weight 31.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met280-Leu534
Aliases /Synonyms ZNF671, Zinc finger protein 671
Reference ARO-P11384
Note For research use only.
Molecular Constructor
Met280–Leu534
Product name ARO-P11384-1MG
Uniprot ID Q8TAW3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGQRYHRCGECGKAFTRKDTLARHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFFRQISGLIEHRRVHTGERLYQCGKCGKFFSSKSNLIRHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHTGERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYECSKCGKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL
Molecular weight 31.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met280-Leu534
Aliases /Synonyms ZNF671, Zinc finger protein 671
Reference ARO-P11384
Note For research use only.
Molecular Constructor
Met280–Leu534
Product name ARO-P11384-50
Uniprot ID Q8TAW3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGQRYHRCGECGKAFTRKDTLARHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFFRQISGLIEHRRVHTGERLYQCGKCGKFFSSKSNLIRHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHTGERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYECSKCGKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL
Molecular weight 31.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met280-Leu534
Aliases /Synonyms ZNF671, Zinc finger protein 671
Reference ARO-P11384
Note For research use only.
Molecular Constructor
Met280–Leu534

Introduction

Recombinant Human ZNF671 Protein, also known as Zinc Finger Protein 671, is a protein that is encoded by the ZNF671 gene in humans. It belongs to the C2H2-type zinc finger protein family and plays a crucial role in various cellular processes. In this article, we will discuss the structure, activity, and applications of this recombinant protein.

Structure of Recombinant Human ZNF671 Protein

The ZNF671 gene is located on chromosome 19 and consists of 5 exons. The protein is composed of 365 amino acids and has a molecular weight of approximately 40 kDa. It contains 7 C2H2-type zinc finger domains, which are responsible for its DNA-binding activity. These zinc finger domains are arranged in a tandem pattern and are connected by short linker sequences. The structure of ZNF671 protein is highly conserved among different species, indicating its importance in biological processes.

Activity of Recombinant Human ZNF671 Protein

Recombinant Human ZNF671 Protein is a transcription factor that regulates gene expression by binding to specific DNA sequences. It has been shown to bind to GC-rich regions of DNA and can either activate or repress gene expression depending on the target gene. This protein has been found to play a role in various cellular processes such as cell proliferation, differentiation, and apoptosis. It also interacts with other proteins to form complexes that regulate gene expression.

Applications of Recombinant Human ZNF671 Protein

Recombinant Human ZNF671 Protein has a wide range of applications in both research and medical fields. Some of the major applications are listed below:

1. Recombinant Protein Production

Recombinant Human ZNF671 Protein can be produced in large quantities using recombinant DNA technology. This protein can be expressed in different host systems such as bacteria, yeast, and mammalian cells. It is used as a tool in various biochemical and biophysical studies due to its ability to bind to specific DNA sequences.

2. Antigen for Antibody Production

Recombinant Human ZNF671 Protein can be used as an antigen to produce specific antibodies. These antibodies can be used for various applications such as immunohistochemistry, western blotting, and immunoprecipitation. They can also be used in diagnostic tests to detect the presence of ZNF671 protein in biological samples.

3. Functional Studies

Recombinant Human ZNF671 Protein can be used in functional studies to understand its role in different biological processes. Its DNA-binding activity can be studied using techniques such as electrophoretic mobility shift assay (EMSA) and chromatin immunoprecipitation (ChIP). These studies can provide insights into the molecular mechanisms of gene regulation by ZNF671 protein.

4. Therapeutic Applications

Aberrant expression of ZNF671 protein has been linked to various diseases such as cancer and neurological disorders. Recombinant Human ZNF671 Protein can be used in drug discovery and development to target this protein and potentially treat these diseases. It can also be used as a biomarker for disease diagnosis and prognosis.

5. Gene Therapy

Recombinant Human ZNF671 Protein can be used in gene therapy to regulate gene expression in specific cells or tissues. This can be achieved by using ZNF671 protein as a transcriptional activator or repressor, depending on the target gene. This approach has potential applications in treating genetic disorders and other diseases caused by abnormal gene expression.

Conclusion</

Recombinant Human ZNF671 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ZNF671 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products