Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DHX15 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O43143
Molecular weight:
29.13 kDa

Original price was: $426.00.Current price is: $327.00.

100ug 23% OFF + 327 loyalty points
Asp568–Tyr795
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DHX15 Protein, N-His

Product name ARO-P11976-100
Uniprot ID O43143
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY
Molecular weight 29.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp568-Tyr795
Aliases /Synonyms DDX15, DEAH box protein 15, Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15, DHX15, DBP1, ATP-dependent RNA helicase #46
Reference ARO-P11976
Note For research use only.
Molecular Constructor
Asp568–Tyr795
Product name ARO-P11976-1MG
Uniprot ID O43143
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY
Molecular weight 29.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp568-Tyr795
Aliases /Synonyms DDX15, DEAH box protein 15, Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15, DHX15, DBP1, ATP-dependent RNA helicase #46
Reference ARO-P11976
Note For research use only.
Molecular Constructor
Asp568–Tyr795
Product name ARO-P11976-50
Uniprot ID O43143
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY
Molecular weight 29.13 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp568-Tyr795
Aliases /Synonyms DDX15, DEAH box protein 15, Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15, DHX15, DBP1, ATP-dependent RNA helicase #46
Reference ARO-P11976
Note For research use only.
Molecular Constructor
Asp568–Tyr795

Introduction

Recombinant Human DHX15 Protein, also known as DExH-Box Helicase 15, is a highly conserved protein that plays a crucial role in various cellular processes. It belongs to the DExH/D box family of helicases, which are enzymes involved in the unwinding of nucleic acids. DHX15 is encoded by the DHX15 gene and is expressed in almost all tissues in the human body.

Structure of Recombinant Human DHX15 Protein

The recombinant form of DHX15 is produced through genetic engineering techniques, where the gene encoding DHX15 is inserted into a host organism, such as bacteria or yeast, to produce large quantities of the protein. The resulting protein is then purified and used for various scientific and medical applications.

DHX15 is a large protein with a molecular weight of approximately 130 kDa. It consists of two main domains, the N-terminal domain and the C-terminal domain, connected by a flexible linker region. The N-terminal domain contains the DExH helicase motif, which is responsible for the helicase activity of DHX15. The C-terminal domain contains the ATPase domain, which is essential for the energy-dependent unwinding of nucleic acids.

Activity of Recombinant Human DHX15 Protein

DHX15 is a multifunctional protein that has been shown to have helicase, ATPase, and RNA-binding activities. Its main function is to unwind double-stranded RNA (dsRNA) molecules, which are formed during various cellular processes, such as transcription, translation, and RNA processing. DHX15 uses energy from ATP hydrolysis to translocate along the RNA molecule, separating the two strands and allowing for further processing.

In addition to its helicase activity, DHX15 has been shown to play a role in several other cellular processes. It has been implicated in DNA replication, repair, and recombination, as well as mRNA splicing and translation. DHX15 has also been found to interact with other proteins involved in RNA processing, suggesting its involvement in the regulation of gene expression.

Application of Recombinant Human DHX15 Protein

The recombinant form of DHX15 has a wide range of applications in the fields of molecular biology and medicine. Its helicase activity makes it a valuable tool for studying the structure and function of RNA molecules. DHX15 has been used in various in vitro assays to study RNA unwinding and processing, as well as in vivo experiments to investigate its role in cellular processes.

DHX15 has also been identified as a potential therapeutic target for various diseases. Its involvement in DNA repair and recombination makes it a promising target for cancer treatment, as inhibition of DHX15 could lead to increased sensitivity of cancer cells to DNA-damaging agents. In addition, DHX15 has been linked to neurodegenerative diseases, such as Alzheimer’s and Parkinson’s, making it a potential target for drug development in these areas.

Furthermore, the recombinant form of DHX15 can be used as an antigen in antibody production for research and diagnostic purposes. Antibodies against DHX15 have been shown to be useful in detecting the protein in various tissues and for studying its expression and localization in different cellular compartments.

Conclusion

In summary, Recombinant Human DHX15 Protein is a versatile protein with important roles in various cellular processes. Its structure and activity make it a valuable tool for studying RNA molecules and its potential as a therapeutic target makes it an exciting area of research. With the availability of recombinant DHX15, scientists and medical professionals can continue to explore its functions and potential applications in various fields.

Recombinant Human DHX15 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DHX15 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products