Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NOL3 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O60936
Molecular weight:
22.85 kDa

Original price was: $393.00.Current price is: $327.00.

100ug 17% OFF + 327 loyalty points
Gly2–Gly85
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NOL3 Protein, N-His-SUMO & C-Strep

Product name ARO-P11813-100
Uniprot ID O60936
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAG
Molecular weight 22.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Gly85
Aliases /Synonyms ARC, Myp, Apoptosis repressor with CARD, Muscle-enriched cytoplasmic protein, NOL3, NOP, Nucleolar protein of 30 kDa, Nucleolar protein 3, Nop30
Reference ARO-P11813
Note For research use only.
Molecular Constructor
Gly2–Gly85
Product name ARO-P11813-1MG
Uniprot ID O60936
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAG
Molecular weight 22.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Gly85
Aliases /Synonyms ARC, Myp, Apoptosis repressor with CARD, Muscle-enriched cytoplasmic protein, NOL3, NOP, Nucleolar protein of 30 kDa, Nucleolar protein 3, Nop30
Reference ARO-P11813
Note For research use only.
Molecular Constructor
Gly2–Gly85
Product name ARO-P11813-50
Uniprot ID O60936
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAG
Molecular weight 22.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Gly85
Aliases /Synonyms ARC, Myp, Apoptosis repressor with CARD, Muscle-enriched cytoplasmic protein, NOL3, NOP, Nucleolar protein of 30 kDa, Nucleolar protein 3, Nop30
Reference ARO-P11813
Note For research use only.
Molecular Constructor
Gly2–Gly85

Recombinant Human NOL3 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human NOL3 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products