Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MDK/Midkine Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P21741
Molecular weight:
20.95 kDa

Original price was: $309.00.Current price is: $274.00.

50ug 11% OFF + 274 loyalty points
Asp51–Thr127
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MDK/Midkine Protein, N-His-SUMO

Product name ARO-P10791-100
Uniprot ID P21741
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCT
Molecular weight 20.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp51-Thr127
Aliases /Synonyms Amphiregulin-associated protein, Midgestation and kidney protein, NEGF2, MDK, ARAP, MK1, Neurite outgrowth-promoting factor 2, MK, Midkine, Neurite outgrowth-promoting protein
Reference ARO-P10791
Note For research use only.
Molecular Constructor
Asp51–Thr127
Product name ARO-P10791-1MG
Uniprot ID P21741
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCT
Molecular weight 20.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp51-Thr127
Aliases /Synonyms Amphiregulin-associated protein, Midgestation and kidney protein, NEGF2, MDK, ARAP, MK1, Neurite outgrowth-promoting factor 2, MK, Midkine, Neurite outgrowth-promoting protein
Reference ARO-P10791
Note For research use only.
Molecular Constructor
Asp51–Thr127
Product name ARO-P10791-50
Uniprot ID P21741
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCT
Molecular weight 20.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp51-Thr127
Aliases /Synonyms Amphiregulin-associated protein, Midgestation and kidney protein, NEGF2, MDK, ARAP, MK1, Neurite outgrowth-promoting factor 2, MK, Midkine, Neurite outgrowth-promoting protein
Reference ARO-P10791
Note For research use only.
Molecular Constructor
Asp51–Thr127

Introduction to Recombinant Human MDK/Midkine Protein

Recombinant Human MDK/Midkine Protein, also known as Midkine, is a small heparin-binding growth factor that plays a crucial role in various biological processes, including cell growth, differentiation, and migration. It is a 13 kDa protein that is encoded by the MDK gene and is expressed in various tissues, including the brain, kidney, and liver. Recombinant Human MDK/Midkine Protein is a synthetic version of the naturally occurring protein, produced through recombinant DNA technology, and has been extensively studied for its potential therapeutic applications.

Structure of Recombinant Human MDK/Midkine Protein

Recombinant Human MDK/Midkine Protein is a homodimer, meaning it is composed of two identical subunits. Each subunit consists of 121 amino acids and contains two domains: an N-terminal domain and a C-terminal domain. The N-terminal domain is responsible for the heparin-binding activity of the protein, while the C-terminal domain is essential for its growth factor activity. The two subunits are held together by disulfide bonds, which are critical for the stability of the protein.

In addition to its primary structure, Recombinant Human MDK/Midkine Protein also has a unique tertiary structure. It forms a compact, globular structure, with the N-terminal domain forming a beta-sheet and the C-terminal domain forming an alpha-helix. This structure is crucial for the protein’s biological activity, as it allows it to interact with its receptors and other molecules in the body.

Activity of Recombinant Human MDK/Midkine Protein

Recombinant Human MDK/Midkine Protein has a wide range of biological activities, making it a versatile molecule with potential therapeutic applications. One of its main functions is to promote cell proliferation and survival. It does this by binding to its receptor, anaplastic lymphoma kinase (ALK), and activating downstream signaling pathways that stimulate cell growth and prevent cell death.

In addition to its role in cell growth, Recombinant Human MDK/Midkine Protein also plays a crucial role in cell migration. It helps cells move to different locations in the body by interacting with other proteins, such as integrins, which are involved in cell adhesion and movement. This activity is essential during embryonic development, wound healing, and tissue regeneration.

Furthermore, Recombinant Human MDK/Midkine Protein has been shown to have anti-inflammatory properties. It can inhibit the production of pro-inflammatory cytokines and promote the secretion of anti-inflammatory cytokines, making it a potential therapeutic agent for inflammatory diseases.

Application of Recombinant Human MDK/Midkine Protein

Due to its diverse biological activities, Recombinant Human MDK/Midkine Protein has been studied for its potential therapeutic applications in various diseases and conditions. Some of the key areas of research include cancer, cardiovascular diseases, and neurological disorders.

In cancer, Recombinant Human MDK/Midkine Protein has been shown to promote tumor growth and metastasis by stimulating cell proliferation and migration. Therefore, it is being investigated as a potential target for cancer therapy. On the other hand, in cardiovascular diseases, Recombinant Human MDK/Midkine Protein has shown promising results in promoting angiogenesis and tissue repair, making it a potential treatment for heart attack and stroke.

In neurological disorders, Recombinant Human MDK/Midkine Protein has been shown to have neuroprotective effects and promote nerve regeneration, making it a potential treatment for conditions such as spinal cord injury and neurodegenerative diseases.

Conclusion

In summary, Recombinant Human MDK/Midkine Protein is a small growth factor with diverse biological activities. Its structure, activity, and potential therapeutic applications make

Recombinant Human MDK/Midkine Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human MDK/Midkine Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products