Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GAP43 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P17677
Molecular weight:
17.84 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Asn14–Ala62
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GAP43 Protein, N-His-SUMO

Product name ARO-P10794-100
Uniprot ID P17677
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAA
Molecular weight 17.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn14-Ala62
Aliases /Synonyms Neural phosphoprotein B-50, pp46, Neuromodulin, Axonal membrane protein GAP-43, GAP43, Growth-associated protein 43
Reference ARO-P10794
Note For research use only.
Molecular Constructor
Asn14–Ala62
Product name ARO-P10794-1MG
Uniprot ID P17677
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAA
Molecular weight 17.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn14-Ala62
Aliases /Synonyms Neural phosphoprotein B-50, pp46, Neuromodulin, Axonal membrane protein GAP-43, GAP43, Growth-associated protein 43
Reference ARO-P10794
Note For research use only.
Molecular Constructor
Asn14–Ala62
Product name ARO-P10794-50
Uniprot ID P17677
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAA
Molecular weight 17.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn14-Ala62
Aliases /Synonyms Neural phosphoprotein B-50, pp46, Neuromodulin, Axonal membrane protein GAP-43, GAP43, Growth-associated protein 43
Reference ARO-P10794
Note For research use only.
Molecular Constructor
Asn14–Ala62

Recombinant Human GAP43 Protein: Structure, Activity, and Application

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of specific proteins. One such recombinant protein is the Recombinant Human GAP43 Protein, which has gained significant attention in the field of neuroscience due to its unique structure and diverse range of functions. In this article, we will explore the structure, activity, and application of Recombinant Human GAP43 Protein.

Structure of Recombinant Human GAP43 Protein

Recombinant Human GAP43 Protein is a 43-kDa protein that belongs to the growth-associated protein (GAP) family. It is composed of 3 domains: an N-terminal domain, a central domain, and a C-terminal domain. The N-terminal domain contains a myristoylation site, which allows the protein to attach to the cell membrane. The central domain contains multiple phosphorylation sites, which are crucial for the protein’s activity. The C-terminal domain contains a calmodulin-binding domain, which is responsible for the protein’s interaction with calmodulin, a calcium-binding protein.

Activity of Recombinant Human GAP43 Protein

Recombinant Human GAP43 Protein is primarily known for its role in neuronal development and plasticity. It is highly expressed in developing neurons and is involved in axonal growth and guidance. The myristoylation of the protein allows it to attach to the cell membrane, where it can interact with other proteins and signaling molecules to regulate neuronal growth. The central domain of the protein contains multiple phosphorylation sites, which can be activated by various kinases. This phosphorylation plays a crucial role in the protein’s activity, as it can modulate its interaction with other proteins and its ability to regulate neuronal growth.

In addition to its role in neuronal development, Recombinant Human GAP43 Protein has also been implicated in synaptic plasticity and memory formation. Studies have shown that the protein is involved in the formation and maintenance of synapses, the connections between neurons. It has also been shown to play a role in long-term potentiation, a process that strengthens the connections between neurons and is crucial for learning and memory.

Application of Recombinant Human GAP43 Protein

Due to its diverse range of functions, Recombinant Human GAP43 Protein has potential applications in various fields, including neuroscience, regenerative medicine, and drug development. In neuroscience, the protein can be used as a tool to study neuronal development, plasticity, and memory formation. It can also be used to investigate the role of specific kinases in the phosphorylation of the protein and its effects on neuronal activity.

In regenerative medicine, Recombinant Human GAP43 Protein has shown promise in promoting nerve regeneration and repair. Studies have demonstrated that the protein can stimulate axonal growth and enhance the formation of new synapses, making it a potential therapeutic target for nerve injuries and neurodegenerative diseases.

Furthermore, Recombinant Human GAP43 Protein can also be used in drug development. As the protein is involved in various signaling pathways and interactions with other proteins, it can serve as a target for drug discovery. Modulating its activity or phosphorylation can potentially lead to the development of new treatments for neurological disorders.

Conclusion

In conclusion, Recombinant Human GAP43 Protein is a 43-kDa protein that plays a crucial role in neuronal development, plasticity, and memory formation. Its unique structure, with myristoylation, phosphorylation, and calmodulin-binding domains, allows it to carry out

Recombinant Human GAP43 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human GAP43 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products