Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant KSI tag Control Protein (N-His)

Host species:
Escherichia coli (E.coli)
Origin species:
Pseudomonas testosteroni
Uniprot ID:
P00947
Molecular weight:
18.04 kDa

Original price was: $312.00.Current price is: $271.00.

50ug 13% OFF + 271 loyalty points
Met1–Ala123
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant KSI tag Control Protein (N-His)

Recombinant KSI tag Control Protein (N-His)

Product name ARO-P16749-100
Uniprot ID P00947
Origin species Pseudomonas testosteroni
Expression system Prokaryotic expression
Raw Antigen Sequence MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHA
Molecular weight 18.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala123
Aliases /Synonyms KSI tag, KSI-tag, Steroid Delta-isomerase, Delta(5)-3-ketosteroid isomerase
Reference ARO-P16749
Note For research use only.
Molecular Constructor
Met1–Ala123
Product name ARO-P16749-1MG
Uniprot ID P00947
Origin species Pseudomonas testosteroni
Expression system Prokaryotic expression
Raw Antigen Sequence MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHA
Molecular weight 18.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala123
Aliases /Synonyms KSI tag, KSI-tag, Steroid Delta-isomerase, Delta(5)-3-ketosteroid isomerase
Reference ARO-P16749
Note For research use only.
Molecular Constructor
Met1–Ala123
Product name ARO-P16749-50
Uniprot ID P00947
Origin species Pseudomonas testosteroni
Expression system Prokaryotic expression
Raw Antigen Sequence MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHA
Molecular weight 18.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala123
Aliases /Synonyms KSI tag, KSI-tag, Steroid Delta-isomerase, Delta(5)-3-ketosteroid isomerase
Reference ARO-P16749
Note For research use only.
Molecular Constructor
Met1–Ala123

There are no reviews yet.

Be the first to review “Recombinant KSI tag Control Protein (N-His)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products