Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ANGPT2/Ang2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
O35608
Molecular weight:
26.47 kDa

Original price was: $345.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Asp283–Phe496
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ANGPT2/Ang2 Protein, N-His

Product name ARO-P11113-100
Uniprot ID O35608
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Molecular weight 26.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp283-Phe496
Aliases /Synonyms Agpt2, Angpt2, Angiopoietin-2, ANG-2
Reference ARO-P11113
Note For research use only.
Molecular Constructor
Asp283–Phe496
Product name ARO-P11113-1MG
Uniprot ID O35608
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Molecular weight 26.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp283-Phe496
Aliases /Synonyms Agpt2, Angpt2, Angiopoietin-2, ANG-2
Reference ARO-P11113
Note For research use only.
Molecular Constructor
Asp283–Phe496
Product name ARO-P11113-50
Uniprot ID O35608
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Molecular weight 26.47 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp283-Phe496
Aliases /Synonyms Agpt2, Angpt2, Angiopoietin-2, ANG-2
Reference ARO-P11113
Note For research use only.
Molecular Constructor
Asp283–Phe496

Introduction

Recombinant Mouse ANGPT2/Ang2 Protein is a genetically engineered version of the naturally occurring protein ANGPT2, also known as angiopoietin-2. This protein plays a crucial role in regulating blood vessel formation and maintenance, making it a valuable tool in various scientific and medical applications. In this article, we will explore the structure, activity, and applications of this recombinant protein.

Structure of Recombinant Mouse ANGPT2/Ang2 Protein

The recombinant version of ANGPT2 is produced by inserting the gene encoding for the protein into a host organism, typically a bacterial or mammalian cell. This allows for large-scale production of the protein for research and therapeutic purposes. The resulting protein has the same amino acid sequence as the natural ANGPT2, but may have slight differences in post-translational modifications.

The protein is composed of 496 amino acids and has a molecular weight of approximately 57 kDa. It consists of an N-terminal coiled-coil domain, a central fibrinogen-like domain, and a C-terminal fibrinogen-like domain. These domains are essential for the protein’s function in regulating blood vessel growth and permeability.

Activity of Recombinant Mouse ANGPT2/Ang2 Protein

ANGPT2 is a key regulator of blood vessel development and maintenance. It acts as an antagonist to another protein, ANGPT1, which promotes blood vessel stability. ANGPT2 binds to the Tie2 receptor on endothelial cells, the cells that line the inside of blood vessels, and inhibits the signaling pathway activated by ANGPT1. This leads to destabilization of blood vessels and promotes angiogenesis, the formation of new blood vessels.

In addition to its role in angiogenesis, ANGPT2 also plays a role in inflammation and tissue repair. It has been shown to promote the migration of immune cells to sites of injury and infection, aiding in the healing process.

Applications of Recombinant Mouse ANGPT2/Ang2 Protein

The recombinant version of ANGPT2 has a wide range of applications in scientific research and potential therapeutic use. Some of the major applications include:

Angiogenesis studies

As ANGPT2 is a key regulator of angiogenesis, the recombinant protein is commonly used in studies to understand the mechanisms of blood vessel formation and maintenance. It can be used to induce or inhibit angiogenesis in various in vitro and in vivo models, allowing researchers to investigate the role of ANGPT2 in different physiological and pathological conditions.

Cancer research

Angiogenesis is a crucial process in tumor growth and metastasis. The recombinant ANGPT2 protein has been used in cancer research to study the role of this protein in promoting tumor angiogenesis. It has also been investigated as a potential therapeutic target for anti-angiogenic cancer treatments.

Tissue engineering

Recombinant ANGPT2 has also been used in tissue engineering applications to promote the formation of new blood vessels in engineered tissues. This can aid in the development of functional and vascularized tissues for various medical applications.

Therapeutic potential

Due to its role in promoting angiogenesis and tissue repair, ANGPT2 has been investigated as a potential therapeutic agent for various diseases. It has shown promising results in preclinical studies for the treatment of cardiovascular diseases, wound healing, and inflammatory disorders.

Conclusion

Recombinant Mouse ANGPT2/Ang2 Protein is a valuable tool in scientific research and has potential therapeutic applications. Its structure and activity make it a crucial regulator of blood vessel formation and maintenance, with implications in various physiological and pathological processes. Further research and development of this protein may lead to new treatments for diseases related to angiogenesis and tissue repair.

Recombinant Mouse ANGPT2/Ang2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ANGPT2/Ang2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products