Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse SIGLEC10/SLG2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q80ZE3
Molecular weight:
59.57 kDa

Original price was: $328.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Gln18–Ser528
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse SIGLEC10/SLG2 Protein, N-His

Product name ARO-P11072-100
Uniprot ID Q80ZE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GQMESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTT
Molecular weight 59.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Ser528
Aliases /Synonyms Sialic acid-binding Ig-like lectin 10, Siglec10, Siglec-G, mSiglec-G, Siglecg, Sialic acid-binding Ig-like lectin G, Siglec-10
Reference ARO-P11072
Note For research use only.
Molecular Constructor
Gln18–Ser528
Product name ARO-P11072-1MG
Uniprot ID Q80ZE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GQMESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTT
Molecular weight 59.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Ser528
Aliases /Synonyms Sialic acid-binding Ig-like lectin 10, Siglec10, Siglec-G, mSiglec-G, Siglecg, Sialic acid-binding Ig-like lectin G, Siglec-10
Reference ARO-P11072
Note For research use only.
Molecular Constructor
Gln18–Ser528
Product name ARO-P11072-50
Uniprot ID Q80ZE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GQMESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTT
Molecular weight 59.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln18-Ser528
Aliases /Synonyms Sialic acid-binding Ig-like lectin 10, Siglec10, Siglec-G, mSiglec-G, Siglecg, Sialic acid-binding Ig-like lectin G, Siglec-10
Reference ARO-P11072
Note For research use only.
Molecular Constructor
Gln18–Ser528

Introduction to Recombinant Mouse SIGLEC10/SLG2 Protein

Recombinant Mouse SIGLEC10/SLG2 Protein is a type of recombinant protein that has been produced through genetic engineering techniques. It is a mouse protein that belongs to the SIGLEC (sialic acid-binding immunoglobulin-like lectins) family, specifically the SIGLEC-10 subgroup. This protein is also known as SLG2 (SIGLEC-like gene 2) and is encoded by the Siglec10 gene.

Structure of Recombinant Mouse SIGLEC10/SLG2 Protein

Recombinant Mouse SIGLEC10/SLG2 Protein is a transmembrane protein with a molecular weight of approximately 70 kDa. It is composed of 572 amino acids and has a single transmembrane domain, a cytoplasmic domain, and an extracellular domain. The extracellular domain contains two immunoglobulin-like domains, a V-set domain and a C2-set domain, which are characteristic of the SIGLEC family.

Activity of Recombinant Mouse SIGLEC10/SLG2 Protein

Recombinant Mouse SIGLEC10/SLG2 Protein is a member of the SIGLEC family, which are cell surface receptors that bind to sialic acid-containing glycans. Sialic acids are a type of sugar that are commonly found on the surface of cells and play important roles in cell-cell interactions and immune responses. SIGLEC proteins, including SIGLEC10/SLG2, have been shown to modulate immune responses by regulating the activation and function of immune cells.

The extracellular domain of Recombinant Mouse SIGLEC10/SLG2 Protein is responsible for binding to sialic acid-containing glycans. Upon binding, it can either activate or inhibit signaling pathways in immune cells, depending on the type of sialic acid and the downstream signaling molecules involved. This activity of SIGLEC10/SLG2 is important for maintaining immune homeostasis and preventing excessive immune responses.

Applications of Recombinant Mouse SIGLEC10/SLG2 Protein

Recombinant Mouse SIGLEC10/SLG2 Protein has a wide range of applications in both basic research and clinical settings. Its ability to modulate immune responses makes it a valuable tool for studying the immune system and its role in various diseases. Some potential applications of this protein include:

– Studying immune cell activation and signaling: Recombinant Mouse SIGLEC10/SLG2 Protein can be used to investigate the role of sialic acid-binding proteins in immune cell activation and signaling. This can provide insights into the mechanisms underlying immune responses and help identify potential targets for therapeutic intervention.

– Developing therapeutic interventions for autoimmune diseases: As an immune modulator, Recombinant Mouse SIGLEC10/SLG2 Protein has the potential to be used as a therapeutic agent for autoimmune diseases. By targeting specific sialic acid-containing glycans, it can regulate immune responses and potentially prevent or treat autoimmune disorders.

– Investigating the role of sialic acids in cancer: Sialic acids are known to play important roles in cancer progression and metastasis. Recombinant Mouse SIGLEC10/SLG2 Protein can be used to study the interactions between cancer cells and the immune system, and potentially identify new therapeutic targets for cancer treatment.

– Developing diagnostic tools for infectious diseases: Many pathogens, including viruses and bacteria, have sialic acids on their surface that can interact with SIGLEC proteins. Recombinant Mouse SIGLEC10/SLG2 Protein can be used to develop diagnostic tools for detecting these pathogens and monitoring their interactions with the immune system.

Conclusion

Recombinant Mouse SIGLEC10/SLG2 Protein is a valuable tool for studying the immune system and its role in various diseases. Its structure, activity, and applications make it a versatile protein that can be used in a wide range of research and clinical settings. By understanding the functions of SIGLEC10/SLG2, we can gain insights into the complex

Recombinant Mouse SIGLEC10/SLG2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse SIGLEC10/SLG2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products