Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD226/DNAM-1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q8K4F0
Molecular weight:
28.20 kDa

Original price was: $509.00.Current price is: $392.00.

100ug 23% OFF + 392 loyalty points
Thr26–Pro254
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD226/DNAM-1 Protein, N-His

Product name ARO-P11075-100
Uniprot ID Q8K4F0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
Molecular weight 28.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Pro254
Aliases /Synonyms CD226 antigen, Platelet and T-cell activation antigen 1, Pta1, CD226, Cd226
Reference ARO-P11075
Note For research use only.
Molecular Constructor
Thr26–Pro254
Product name ARO-P11075-1MG
Uniprot ID Q8K4F0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
Molecular weight 28.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Pro254
Aliases /Synonyms CD226 antigen, Platelet and T-cell activation antigen 1, Pta1, CD226, Cd226
Reference ARO-P11075
Note For research use only.
Molecular Constructor
Thr26–Pro254
Product name ARO-P11075-50
Uniprot ID Q8K4F0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
Molecular weight 28.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Pro254
Aliases /Synonyms CD226 antigen, Platelet and T-cell activation antigen 1, Pta1, CD226, Cd226
Reference ARO-P11075
Note For research use only.
Molecular Constructor
Thr26–Pro254

Introduction to Recombinant Mouse CD226/DNAM-1 Protein

Recombinant Mouse CD226/DNAM-1 protein is a type I transmembrane glycoprotein that belongs to the immunoglobulin superfamily. It is encoded by the CD226 gene and is also known as DNAM-1 (DNAX accessory molecule-1). This protein is expressed on the surface of various immune cells, including natural killer (NK) cells, T cells, and monocytes. It plays a crucial role in regulating immune responses and has been shown to be involved in various diseases, including cancer and autoimmune disorders.

Structure of Recombinant Mouse CD226/DNAM-1 Protein

Recombinant Mouse CD226/DNAM-1 protein is composed of 366 amino acids and has a molecular weight of approximately 43 kDa. It consists of two extracellular immunoglobulin-like domains, a transmembrane domain, and a cytoplasmic tail. The extracellular domains are responsible for binding to ligands, while the cytoplasmic tail contains signaling motifs that mediate downstream signaling.

Activity of Recombinant Mouse CD226/DNAM-1 Protein

Recombinant Mouse CD226/DNAM-1 protein is a key regulator of immune responses. It functions as a co-stimulatory molecule on T cells and NK cells, enhancing their activation and effector functions. It also acts as a co-inhibitory molecule on dendritic cells and macrophages, suppressing their activation and cytokine production. This dual role of CD226/DNAM-1 allows for fine-tuning of immune responses and helps maintain immune homeostasis.

One of the main functions of CD226/DNAM-1 is its ability to bind to its ligands, CD155 and CD112, which are expressed on target cells. This interaction leads to the activation of downstream signaling pathways, including the PI3K/Akt and MAPK pathways, resulting in the production of cytokines and chemokines. These molecules play a crucial role in immune cell recruitment, activation, and proliferation.

In addition to its role in immune cell activation, CD226/DNAM-1 has also been shown to play a role in immune cell-mediated cytotoxicity. It promotes the killing of target cells by NK cells and CD8+ T cells through the release of cytotoxic molecules, such as perforin and granzymes. This function is particularly important in the immune response against viruses and tumors.

Application of Recombinant Mouse CD226/DNAM-1 Protein

Recombinant Mouse CD226/DNAM-1 protein has a wide range of applications in both research and therapeutic settings. Its ability to regulate immune responses and its involvement in various diseases make it a promising target for drug development. Recombinant forms of CD226/DNAM-1 can be used to study its structure, function, and interactions with ligands and other proteins.

In cancer research, CD226/DNAM-1 has been identified as a potential target for immunotherapy. By targeting this protein, it is possible to enhance the anti-tumor immune response and improve the efficacy of cancer treatments. Recombinant forms of CD226/DNAM-1 can be used to develop novel immunotherapies, such as monoclonal antibodies or chimeric antigen receptor (CAR) T cells.

In addition, recombinant CD226/DNAM-1 protein can also be used in diagnostic assays to detect the expression of this protein on immune cells. This can provide valuable information about the immune status of an individual and aid in the diagnosis and monitoring of diseases.

Conclusion

Recombinant Mouse CD226/DNAM-1 protein is a crucial regulator of immune responses with diverse functions in both innate and adaptive immunity. Its structure, activity, and involvement in various diseases make it a promising target for drug development and a useful tool in research. Further studies on this protein may lead to the development of novel therapies for diseases such as cancer and autoimmune

Recombinant Mouse CD226/DNAM-1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD226/DNAM-1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products