Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CHIT1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9D7Q1
Molecular weight:
42.35 kDa

Original price was: $339.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Lys23–Leu383
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CHIT1 Protein, N-His

Product name ARO-P11076-100
Uniprot ID Q9D7Q1
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KLVCYLTNWSQYRTEAVRFFPRDVDPNLCTHVIFAFAGMDNHQLSTVEHNDELLYQELNSLKTKNPKLKTLLAVGGWTFGTQKFTDMVATASNRQTFVKSALSFLRTQGFDGLDLDWEFPGGRGSPTVDKERFTALIQDLAKAFQEEAQSSGKERLLLTAAVPSDRGLVDAGYEVDKIAQSLDFINLMAYDFHSSLEKTTGHNSPLYKRQGESGAAAEQNVDAAVTLWLQKGTPASKLILGMPTYGRSFTLASSSDNGVGAPATGPGAPGPYTKDKGVLAYYEACSWKERHRIEDQKVPYAFQDNQWVSFDDVESFKAKAAYLKQKGLGGAMVWVLDLDDFKGSFCNQGPYPLIRTLRQEL
Molecular weight 42.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-Leu383
Aliases /Synonyms Chitinase-1, Chit1, Chitotriosidase-1
Reference ARO-P11076
Note For research use only.
Molecular Constructor
Lys23–Leu383
Product name ARO-P11076-1MG
Uniprot ID Q9D7Q1
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KLVCYLTNWSQYRTEAVRFFPRDVDPNLCTHVIFAFAGMDNHQLSTVEHNDELLYQELNSLKTKNPKLKTLLAVGGWTFGTQKFTDMVATASNRQTFVKSALSFLRTQGFDGLDLDWEFPGGRGSPTVDKERFTALIQDLAKAFQEEAQSSGKERLLLTAAVPSDRGLVDAGYEVDKIAQSLDFINLMAYDFHSSLEKTTGHNSPLYKRQGESGAAAEQNVDAAVTLWLQKGTPASKLILGMPTYGRSFTLASSSDNGVGAPATGPGAPGPYTKDKGVLAYYEACSWKERHRIEDQKVPYAFQDNQWVSFDDVESFKAKAAYLKQKGLGGAMVWVLDLDDFKGSFCNQGPYPLIRTLRQEL
Molecular weight 42.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-Leu383
Aliases /Synonyms Chitinase-1, Chit1, Chitotriosidase-1
Reference ARO-P11076
Note For research use only.
Molecular Constructor
Lys23–Leu383
Product name ARO-P11076-50
Uniprot ID Q9D7Q1
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KLVCYLTNWSQYRTEAVRFFPRDVDPNLCTHVIFAFAGMDNHQLSTVEHNDELLYQELNSLKTKNPKLKTLLAVGGWTFGTQKFTDMVATASNRQTFVKSALSFLRTQGFDGLDLDWEFPGGRGSPTVDKERFTALIQDLAKAFQEEAQSSGKERLLLTAAVPSDRGLVDAGYEVDKIAQSLDFINLMAYDFHSSLEKTTGHNSPLYKRQGESGAAAEQNVDAAVTLWLQKGTPASKLILGMPTYGRSFTLASSSDNGVGAPATGPGAPGPYTKDKGVLAYYEACSWKERHRIEDQKVPYAFQDNQWVSFDDVESFKAKAAYLKQKGLGGAMVWVLDLDDFKGSFCNQGPYPLIRTLRQEL
Molecular weight 42.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys23-Leu383
Aliases /Synonyms Chitinase-1, Chit1, Chitotriosidase-1
Reference ARO-P11076
Note For research use only.
Molecular Constructor
Lys23–Leu383

Introduction

Recombinant Mouse CHIT1 Protein is a highly versatile and biologically active protein that has been extensively studied in the field of immunology and biotechnology. This protein is derived from the chitinase 1 gene in mice and has been produced through recombinant DNA technology, making it a valuable tool for various research and industrial applications. In this article, we will explore the structure, activity, and applications of this recombinant protein.

Structure of Recombinant Mouse CHIT1 Protein

The CHIT1 protein is a glycosylated enzyme that belongs to the family of chitinases, which are enzymes that break down chitin, a major component of the cell walls of fungi and insects. The recombinant form of this protein is produced in a host cell, typically E. coli, and has a molecular weight of approximately 50-60 kDa. It is composed of 457 amino acids and has a conserved catalytic domain that is essential for its enzymatic activity.

The structure of Recombinant Mouse CHIT1 Protein also includes a signal peptide, which is responsible for targeting the protein to the secretory pathway. This allows for the protein to be secreted into the extracellular space, where it can exert its biological function.

Activity of Recombinant Mouse CHIT1 Protein

The main activity of Recombinant Mouse CHIT1 Protein is its chitinolytic function, which involves breaking down chitin into smaller fragments. This activity is essential for the digestion of chitin-containing organisms and also plays a role in the immune response against parasitic infections.

In addition to its chitinolytic activity, this recombinant protein has been shown to possess antimicrobial properties. It has been found to inhibit the growth of various pathogenic bacteria, including Staphylococcus aureus and Pseudomonas aeruginosa, by disrupting their cell walls.

Furthermore, Recombinant Mouse CHIT1 Protein has been shown to have immunomodulatory effects. It can stimulate the production of pro-inflammatory cytokines, such as TNF-α and IL-6, and enhance the activity of immune cells, such as macrophages and dendritic cells.

Applications of Recombinant Mouse CHIT1 Protein

Recombinant Mouse CHIT1 Protein has a wide range of applications in both research and industrial settings. Its chitinolytic activity makes it a valuable tool for studying the structure and function of chitin-containing organisms, such as fungi and insects. It can also be used in the production of chitooligosaccharides, which have various industrial and biomedical applications, including wound healing and drug delivery.

Furthermore, the antimicrobial and immunomodulatory properties of this recombinant protein make it a promising candidate for the development of new antimicrobial agents and immunotherapies. It has been studied for its potential use in treating bacterial infections, as well as in cancer immunotherapy.

In addition, Recombinant Mouse CHIT1 Protein has been used in diagnostic assays for the detection of chitinase activity in various biological samples. It has also been incorporated into cosmetic and skincare products for its exfoliating and anti-aging properties.

Conclusion

Recombinant Mouse CHIT1 Protein is a multifunctional and biologically active protein that has numerous applications in various fields. Its structure, activity, and diverse range of functions make it a valuable tool for research and industrial use. As further studies are conducted, it is likely that more applications for this recombinant protein will be discovered, making it an even more valuable asset in the scientific community.

Recombinant Mouse CHIT1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CHIT1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products