Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CDH3/P-cadherin Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P10287
Molecular weight:
25.28 kDa

Original price was: $434.00.Current price is: $392.00.

100ug 10% OFF + 392 loyalty points
Met103–Ala313
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CDH3/P-cadherin Protein, N-His

Product name ARO-P10498-100
Uniprot ID P10287
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPPIFVPENGKGPFPQRLNQLKSNKDRGTKIFYSITGPGADSPPEGVFTIEKESGWLLLHMPLDREKIVKYELYGHAVSENGASVEEPMNISIIVTDQNDNKPKFTQDTFRGSVLEGVMPGTSVMQVTATDEDDAVNTYNGVVAYSIHSQEPKEPHDLMFTIHKSTGTISVISSGLDREKVPEYRLTVQATDMDGEGSTTTAEAVVQILDA
Molecular weight 25.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met103-Ala313
Aliases /Synonyms Placental cadherin, CDH3, Cadherin-3, P-cadherin, CDHP
Reference ARO-P10498
Note For research use only.
Molecular Constructor
Met103–Ala313
Product name ARO-P10498-1MG
Uniprot ID P10287
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPPIFVPENGKGPFPQRLNQLKSNKDRGTKIFYSITGPGADSPPEGVFTIEKESGWLLLHMPLDREKIVKYELYGHAVSENGASVEEPMNISIIVTDQNDNKPKFTQDTFRGSVLEGVMPGTSVMQVTATDEDDAVNTYNGVVAYSIHSQEPKEPHDLMFTIHKSTGTISVISSGLDREKVPEYRLTVQATDMDGEGSTTTAEAVVQILDA
Molecular weight 25.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met103-Ala313
Aliases /Synonyms Placental cadherin, CDH3, Cadherin-3, P-cadherin, CDHP
Reference ARO-P10498
Note For research use only.
Molecular Constructor
Met103–Ala313
Product name ARO-P10498-50
Uniprot ID P10287
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MPPIFVPENGKGPFPQRLNQLKSNKDRGTKIFYSITGPGADSPPEGVFTIEKESGWLLLHMPLDREKIVKYELYGHAVSENGASVEEPMNISIIVTDQNDNKPKFTQDTFRGSVLEGVMPGTSVMQVTATDEDDAVNTYNGVVAYSIHSQEPKEPHDLMFTIHKSTGTISVISSGLDREKVPEYRLTVQATDMDGEGSTTTAEAVVQILDA
Molecular weight 25.28 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met103-Ala313
Aliases /Synonyms Placental cadherin, CDH3, Cadherin-3, P-cadherin, CDHP
Reference ARO-P10498
Note For research use only.
Molecular Constructor
Met103–Ala313

Introduction

Recombinant Mouse CDH3/P-cadherin protein, also known as P-cadherin, is a cell adhesion molecule that plays a crucial role in cell-cell interactions and tissue organization. It is a member of the cadherin superfamily and is expressed in a variety of tissues, including epithelial cells, endothelial cells, and neuronal cells. In this article, we will discuss the structure, activity, and applications of recombinant Mouse CDH3/P-cadherin protein.

Structure of Recombinant Mouse CDH3/P-cadherin Protein

Recombinant Mouse CDH3/P-cadherin protein is a type I transmembrane protein with a molecular weight of approximately 130 kDa. It is composed of five extracellular cadherin domains, a transmembrane domain, and a cytoplasmic domain. The extracellular cadherin domains are responsible for the calcium-dependent homophilic interactions between P-cadherin molecules on adjacent cells. The transmembrane domain anchors the protein to the cell membrane, while the cytoplasmic domain interacts with intracellular signaling molecules.

Activity of Recombinant Mouse CDH3/P-cadherin Protein

Recombinant Mouse CDH3/P-cadherin protein is involved in various cellular processes, including cell adhesion, cell migration, and tissue morphogenesis. It mediates cell-cell adhesion by forming homophilic interactions with other P-cadherin molecules on adjacent cells. This adhesion is calcium-dependent and is essential for maintaining the integrity and stability of tissues.

In addition to its role in cell adhesion, recombinant Mouse CDH3/P-cadherin protein also plays a critical role in cell migration. It has been shown to promote cell migration by regulating the activity of small GTPases, such as RhoA and Rac1. These GTPases are involved in the formation of actin filaments, which are necessary for cell movement.

Furthermore, recombinant Mouse CDH3/P-cadherin protein has been shown to be involved in tissue morphogenesis. It is essential for the proper organization and development of tissues, such as the mammary gland and the nervous system. Studies have also shown that it plays a role in regulating cell proliferation and differentiation.

Applications of Recombinant Mouse CDH3/P-cadherin Protein

Recombinant Mouse CDH3/P-cadherin protein has a wide range of applications in both research and clinical settings. One of its main applications is in cell adhesion studies. Recombinant P-cadherin protein can be used to study the mechanisms of cell adhesion and its role in tissue organization and development.

In addition, recombinant Mouse CDH3/P-cadherin protein has been used in cancer research. Studies have shown that P-cadherin is overexpressed in various types of cancer, including breast, ovarian, and lung cancer. It has been implicated in promoting tumor growth and metastasis, making it a potential target for cancer therapy. Recombinant Mouse CDH3/P-cadherin protein can be used to study the role of P-cadherin in cancer progression and to develop novel therapeutic strategies.

Furthermore, recombinant Mouse CDH3/P-cadherin protein has potential applications in tissue engineering and regenerative medicine. Its role in tissue morphogenesis and its ability to promote cell migration make it a promising candidate for promoting tissue repair and regeneration.

Conclusion

Recombinant Mouse CDH3/P-cadherin protein is a crucial molecule involved in cell-cell adhesion, cell migration, and tissue morphogenesis. Its structure, activity, and applications have been extensively studied, and it has been implicated in various cellular processes and diseases. Further research on recombinant Mouse CDH3/P-cadherin protein may lead to a better understanding of its role in health and disease, and potentially open up new avenues for therapeutic interventions.

Recombinant Mouse CDH3/P-cadherin Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CDH3/P-cadherin Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products