Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CCN3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q64299
Molecular weight:
22.00 kDa

Original price was: $347.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Ser50–Arg137
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CCN3 Protein, N-His-SUMO

Product name ARO-P11067-100
Uniprot ID Q64299
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPR
Molecular weight 22.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Arg137
Aliases /Synonyms NovH, Cellular communication network factor 3, CCN family member 3, Nephroblastoma-overexpressed gene protein homolog, Protein NOV homolog, Nov, Ccn3
Reference ARO-P11067
Note For research use only.
Molecular Constructor
Ser50–Arg137
Product name ARO-P11067-1MG
Uniprot ID Q64299
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPR
Molecular weight 22.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Arg137
Aliases /Synonyms NovH, Cellular communication network factor 3, CCN family member 3, Nephroblastoma-overexpressed gene protein homolog, Protein NOV homolog, Nov, Ccn3
Reference ARO-P11067
Note For research use only.
Molecular Constructor
Ser50–Arg137
Product name ARO-P11067-50
Uniprot ID Q64299
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPR
Molecular weight 22.00 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Arg137
Aliases /Synonyms NovH, Cellular communication network factor 3, CCN family member 3, Nephroblastoma-overexpressed gene protein homolog, Protein NOV homolog, Nov, Ccn3
Reference ARO-P11067
Note For research use only.
Molecular Constructor
Ser50–Arg137

Recombinant Mouse CCN3 Protein: Structure, Activity and Application

Introduction

Recombinant proteins have become essential tools in various fields of research, diagnostics, and therapeutics. These proteins are produced by cloning and expressing the gene of interest in a host organism, resulting in a highly pure and functional protein. One such recombinant protein is the Recombinant Mouse CCN3 Protein, which has gained significant attention in the scientific community due to its unique structure, activity, and potential applications.

Structure of Recombinant Mouse CCN3 Protein

The Recombinant Mouse CCN3 Protein, also known as NovH, is a member of the CCN (Cyr61, CTGF, Nov) family of proteins. It is a 38 kDa secreted protein that is composed of four distinct structural modules: insulin-like growth factor-binding protein (IGFBP), von Willebrand factor type C (VWC), thrombospondin type 1 (TSP1), and C-terminal cysteine knot (CT). These modules are connected by flexible hinge regions, giving the protein a modular structure.

The IGFBP module is responsible for binding to insulin-like growth factors (IGFs) and regulating their activity, while the VWC module is involved in protein-protein interactions. The TSP1 module is known to bind to a variety of extracellular matrix proteins, and the CT module is responsible for dimerization and receptor binding. The unique structure of Recombinant Mouse CCN3 Protein allows it to interact with a wide range of molecules and play diverse roles in various biological processes.

Activity of Recombinant Mouse CCN3 Protein

Recombinant Mouse CCN3 Protein has been shown to have multiple activities, including cell proliferation, differentiation, and migration. It acts as a potent mitogen for fibroblasts, promoting their proliferation and survival. It also stimulates the differentiation of osteoblasts, chondrocytes, and adipocytes, indicating its role in tissue development and homeostasis.

Moreover, Recombinant Mouse CCN3 Protein has been shown to modulate the activity of various growth factors and cytokines, such as TGF-β, FGF, and VEGF, by binding to their receptors and regulating their signaling pathways. It also has anti-angiogenic properties, inhibiting the formation of new blood vessels, and has been shown to play a role in wound healing and tissue repair.

Application of Recombinant Mouse CCN3 Protein

Due to its diverse activities, Recombinant Mouse CCN3 Protein has potential applications in various fields of research and medicine. Its role in tissue development and homeostasis makes it a valuable tool for studying cell proliferation and differentiation in vitro. It can also be used as a growth factor supplement in cell culture media to enhance cell growth and survival.

Furthermore, Recombinant Mouse CCN3 Protein has potential therapeutic applications. It has been shown to have anti-fibrotic properties, making it a potential treatment for fibrotic diseases such as liver fibrosis and pulmonary fibrosis. Its anti-angiogenic properties also make it a potential anti-cancer agent, as tumors rely on the formation of new blood vessels for their growth and metastasis.

Conclusion

In summary, Recombinant Mouse CCN3 Protein is a unique and versatile protein with a modular structure and diverse activities. Its potential applications in research and medicine make it a valuable tool for understanding and treating various diseases. Further studies on its structure and function may reveal even more potential applications of this intriguing protein.

Keywords:

recombinant protein, antigen,

Recombinant Mouse CCN3 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse CCN3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products