Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Mouse RETN/Resistin Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q99P87
Molecular weight:
35.11 kDa

Original price was: $497.00.Current price is: $392.00.

100ug 21% OFF + 392 loyalty points
Asn50–Ser114
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Mouse RETN/Resistin Protein, N-GST & C-His

Recombinant Mouse RETN/Resistin Protein, N-GST & C-His

Product name ARO-P10476-100
Uniprot ID Q99P87
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
Molecular weight 35.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn50-Ser114
Aliases /Synonyms Cysteine-rich secreted protein A12-alpha-like 2, Adipose tissue-specific secretory factor, FIZZ3, HXCP1, RETN, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein FIZZ3, RSTN, ADSF, Resistin
Reference ARO-P10476
Note For research use only.
Molecular Constructor
Asn50–Ser114
Product name ARO-P10476-1MG
Uniprot ID Q99P87
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
Molecular weight 35.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn50-Ser114
Aliases /Synonyms Cysteine-rich secreted protein A12-alpha-like 2, Adipose tissue-specific secretory factor, FIZZ3, HXCP1, RETN, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein FIZZ3, RSTN, ADSF, Resistin
Reference ARO-P10476
Note For research use only.
Molecular Constructor
Asn50–Ser114
Product name ARO-P10476-50
Uniprot ID Q99P87
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVAS
Molecular weight 35.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn50-Ser114
Aliases /Synonyms Cysteine-rich secreted protein A12-alpha-like 2, Adipose tissue-specific secretory factor, FIZZ3, HXCP1, RETN, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein FIZZ3, RSTN, ADSF, Resistin
Reference ARO-P10476
Note For research use only.
Molecular Constructor
Asn50–Ser114

Recombinant Mouse RETN/Resistin Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse RETN/Resistin Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products