Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CLEC11A Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
O88200
Molecular weight:
44.41 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Gly185–Phe328
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CLEC11A Protein, N-GST & C-His

Product name ARO-P10621-100
Uniprot ID O88200
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GLRLGHKCFLLSRDFETQAAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYLFENGQRVSFFAWHRAFSLESGAQPSAATHPLSPDQPNGGVLENCVAQASDDGSWWDHDCERRLYFVCEFPF
Molecular weight 44.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Phe328
Aliases /Synonyms p47, Lymphocyte secreted C-type lectin, CLECSF3, CLEC11A, Stem cell growth factor, SCGF, Osteolectin, C-type lectin superfamily member 3, LSLCL, C-type lectin domain family 11 member A
Reference ARO-P10621
Note For research use only.
Molecular Constructor
Gly185–Phe328
Product name ARO-P10621-1MG
Uniprot ID O88200
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GLRLGHKCFLLSRDFETQAAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYLFENGQRVSFFAWHRAFSLESGAQPSAATHPLSPDQPNGGVLENCVAQASDDGSWWDHDCERRLYFVCEFPF
Molecular weight 44.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Phe328
Aliases /Synonyms p47, Lymphocyte secreted C-type lectin, CLECSF3, CLEC11A, Stem cell growth factor, SCGF, Osteolectin, C-type lectin superfamily member 3, LSLCL, C-type lectin domain family 11 member A
Reference ARO-P10621
Note For research use only.
Molecular Constructor
Gly185–Phe328
Product name ARO-P10621-50
Uniprot ID O88200
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GLRLGHKCFLLSRDFETQAAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYLFENGQRVSFFAWHRAFSLESGAQPSAATHPLSPDQPNGGVLENCVAQASDDGSWWDHDCERRLYFVCEFPF
Molecular weight 44.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly185-Phe328
Aliases /Synonyms p47, Lymphocyte secreted C-type lectin, CLECSF3, CLEC11A, Stem cell growth factor, SCGF, Osteolectin, C-type lectin superfamily member 3, LSLCL, C-type lectin domain family 11 member A
Reference ARO-P10621
Note For research use only.
Molecular Constructor
Gly185–Phe328

Introduction

Recombinant Mouse CLEC11A Protein, also known as C-type lectin domain family 11 member A, is a protein that plays a crucial role in immune response and tissue repair. This protein is encoded by the CLEC11A gene and is a member of the C-type lectin superfamily. It is highly conserved among mammalian species, with 98% amino acid sequence identity between mouse and human CLEC11A proteins.

Structure of Recombinant Mouse CLEC11A Protein

Recombinant Mouse CLEC11A Protein is a glycoprotein with a molecular weight of approximately 30 kDa. It is composed of 250 amino acids and contains a single C-type lectin domain. This domain is responsible for the binding of carbohydrates and glycoproteins, making CLEC11A a lectin. The protein also contains a short cytoplasmic tail and a transmembrane domain, indicating its localization on the cell surface.

Activity of Recombinant Mouse CLEC11A Protein

Recombinant Mouse CLEC11A Protein is primarily expressed in the bone marrow and has been shown to play a critical role in hematopoiesis, the process of blood cell formation. It is also expressed in other tissues, such as the spleen, thymus, and lymph nodes, where it is involved in immune response and tissue repair.

One of the main activities of CLEC11A is its ability to bind to glycosaminoglycans (GAGs) on the surface of cells. This interaction can activate various signaling pathways, leading to the recruitment and activation of immune cells. CLEC11A has also been shown to bind to several extracellular matrix proteins, such as fibronectin and collagen, which are important for tissue repair and wound healing.

In addition to its role in immune response and tissue repair, CLEC11A has been found to have anti-tumor properties. It has been shown to inhibit the growth and migration of cancer cells, suggesting its potential as a therapeutic target for cancer treatment.

Application of Recombinant Mouse CLEC11A Protein

Recombinant Mouse CLEC11A Protein has been widely used in various research studies to understand its role in immune response and tissue repair. It has also been used in cancer research to investigate its potential as a therapeutic target. Additionally, this protein has been used in the development of diagnostic tools for certain diseases, such as leukemia and lymphoma, as CLEC11A is highly expressed in these types of cancer.

Furthermore, recombinant CLEC11A protein has been used in the development of novel therapies for various conditions. For instance, it has been used in combination with other immune-modulating proteins to enhance immune response against tumors. It has also been utilized in tissue engineering to promote tissue repair and regeneration.

Conclusion

In summary, Recombinant Mouse CLEC11A Protein is a versatile protein with various functions in immune response, tissue repair, and cancer. Its structure, activity, and applications have been extensively studied, and it continues to be a topic of interest in the scientific community. Further research on this protein may lead to the development of novel therapies for various diseases and conditions.

Recombinant Mouse CLEC11A Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CLEC11A Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products