Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD134/TNFRSF4/OX40 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P47741
Molecular weight:
18.56 kDa

Original price was: $326.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Thr31–Thr177
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD134/TNFRSF4/OX40 Protein, N-His

Product name ARO-P10581-100
Uniprot ID P47741
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWET
Molecular weight 18.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Thr177
Aliases /Synonyms ACT35 antigen, TXGP1L, TAX transcriptionally-activated glycoprotein 1 receptor, Tumor necrosis factor receptor superfamily member 4, TNFRSF4, OX40L receptor, CD134
Reference ARO-P10581
Note For research use only.
Molecular Constructor
Thr31–Thr177
Product name ARO-P10581-1MG
Uniprot ID P47741
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWET
Molecular weight 18.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Thr177
Aliases /Synonyms ACT35 antigen, TXGP1L, TAX transcriptionally-activated glycoprotein 1 receptor, Tumor necrosis factor receptor superfamily member 4, TNFRSF4, OX40L receptor, CD134
Reference ARO-P10581
Note For research use only.
Molecular Constructor
Thr31–Thr177
Product name ARO-P10581-50
Uniprot ID P47741
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWET
Molecular weight 18.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Thr177
Aliases /Synonyms ACT35 antigen, TXGP1L, TAX transcriptionally-activated glycoprotein 1 receptor, Tumor necrosis factor receptor superfamily member 4, TNFRSF4, OX40L receptor, CD134
Reference ARO-P10581
Note For research use only.
Molecular Constructor
Thr31–Thr177

Introduction

The recombinant mouse CD134/TNFRSF4/OX40 protein is a type I transmembrane protein that belongs to the tumor necrosis factor receptor superfamily. It is also known as OX40 (CD134) or ACT35 (CD134). This protein is a homodimer and is primarily expressed on activated T cells, but can also be found on B cells, natural killer cells, and dendritic cells. The recombinant form of this protein is commonly used in research and therapeutic applications due to its ability to enhance T cell activation and survival.

Structure of Recombinant Mouse CD134/TNFRSF4/OX40 Protein

The recombinant mouse CD134/TNFRSF4/OX40 protein is composed of 277 amino acids with a predicted molecular weight of approximately 30 kDa. It contains a single transmembrane domain and a cytoplasmic tail that is essential for signaling. The extracellular domain of the protein is composed of four cysteine-rich domains, which are important for ligand binding. The recombinant form of this protein is produced in a mammalian cell expression system and undergoes post-translational modifications, resulting in a protein that closely resembles the native form.

Activity of Recombinant Mouse CD134/TNFRSF4/OX40 Protein

The primary function of the recombinant mouse CD134/TNFRSF4/OX40 protein is to enhance T cell activation and survival. This is achieved through its interaction with its ligand, CD134L, which is expressed on activated antigen-presenting cells. Binding of the recombinant protein to its ligand leads to the activation of downstream signaling pathways, including the NF-κB and MAPK pathways, which promote T cell proliferation and survival. In addition, the recombinant protein can also enhance the production of cytokines, such as IL-2 and IFN-γ, which are important for immune response and inflammation.

Application of Recombinant Mouse CD134/TNFRSF4/OX40 Protein

The recombinant mouse CD134/TNFRSF4/OX40 protein has a wide range of applications in both research and therapeutic settings. In research, it is commonly used as a tool to study T cell activation and survival, as well as the role of the CD134/TNFRSF4/OX40 signaling pathway in various diseases. It is also used in preclinical studies to evaluate the potential of targeting this pathway for therapeutic purposes.

In therapeutic applications, the recombinant protein has shown promising results in treating various diseases, including cancer and autoimmune disorders. Studies have demonstrated that targeting the CD134/TNFRSF4/OX40 pathway can enhance anti-tumor immune responses and improve the efficacy of cancer immunotherapy. In addition, the recombinant protein has also been shown to have a beneficial effect in treating autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis, by promoting immune tolerance and suppressing autoimmunity.

Conclusion

The recombinant mouse CD134/TNFRSF4/OX40 protein is a versatile tool with a wide range of applications in research and therapeutics. Its structure, activity, and application make it a valuable protein for studying T cell activation and survival, as well as for developing novel treatments for various diseases. With ongoing research and development, the potential of this protein in the field of immunology continues to expand, making it an exciting area of study for scientists and clinicians alike.

Recombinant Mouse CD134/TNFRSF4/OX40 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD134/TNFRSF4/OX40 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products