Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse Ifna15 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q61718
Molecular weight:
21.62 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Cys24–Glu190
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse Ifna15 Protein, N-His

Product name ARO-P10534-100
Uniprot ID Q61718
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFRFPQEKVDAQQIQNAQAIPVLQELTQQVLNIFTSKDSSAAWDASLLDSFCNDLHQQLNDLKACVMQEVGVQEPPLTQEDYLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRAMSSSAKLLARLSEEKE
Molecular weight 21.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu190
Aliases /Synonyms Alpha-interferon, Interferon 1ai1, Interferon alpha 15, Predicted gene, OTTMUSG00000007655, Ifna15, Gm12597, If1ai1, MuIFN-alpha-A
Reference ARO-P10534
Note For research use only.
Molecular Constructor
Cys24–Glu190
Product name ARO-P10534-1MG
Uniprot ID Q61718
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFRFPQEKVDAQQIQNAQAIPVLQELTQQVLNIFTSKDSSAAWDASLLDSFCNDLHQQLNDLKACVMQEVGVQEPPLTQEDYLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRAMSSSAKLLARLSEEKE
Molecular weight 21.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu190
Aliases /Synonyms Alpha-interferon, Interferon 1ai1, Interferon alpha 15, Predicted gene, OTTMUSG00000007655, Ifna15, Gm12597, If1ai1, MuIFN-alpha-A
Reference ARO-P10534
Note For research use only.
Molecular Constructor
Cys24–Glu190
Product name ARO-P10534-50
Uniprot ID Q61718
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFRFPQEKVDAQQIQNAQAIPVLQELTQQVLNIFTSKDSSAAWDASLLDSFCNDLHQQLNDLKACVMQEVGVQEPPLTQEDYLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRAMSSSAKLLARLSEEKE
Molecular weight 21.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu190
Aliases /Synonyms Alpha-interferon, Interferon 1ai1, Interferon alpha 15, Predicted gene, OTTMUSG00000007655, Ifna15, Gm12597, If1ai1, MuIFN-alpha-A
Reference ARO-P10534
Note For research use only.
Molecular Constructor
Cys24–Glu190

Introduction to Recombinant Mouse Ifna15 Protein

Recombinant proteins are artificially produced proteins that are derived from genetic material using recombinant DNA technology. These proteins have a wide range of applications in various fields, including medicine, biotechnology, and research. One such important recombinant protein is the Recombinant Mouse Ifna15 Protein.

Structure of Recombinant Mouse Ifna15 Protein

Recombinant Mouse Ifna15 Protein is a cytokine, which is a small protein that plays a crucial role in cell signaling and immune responses. It belongs to the interferon alpha family, specifically the type I interferons. The protein is composed of 166 amino acids and has a molecular weight of approximately 19 kDa. It has a three-dimensional structure that is stabilized by disulfide bonds between cysteine residues.

Activity of Recombinant Mouse Ifna15 Protein

Recombinant Mouse Ifna15 Protein has a wide range of activities in the body, primarily related to its role in the immune system. It is produced by various cells, including immune cells such as macrophages and dendritic cells, in response to viral infections, bacterial infections, and other stimuli. The protein acts as a signaling molecule, binding to specific receptors on target cells and activating intracellular signaling pathways.

One of the key activities of Recombinant Mouse Ifna15 Protein is its role in antiviral defense. It stimulates the production of antiviral proteins, which inhibit viral replication and spread. Additionally, it also enhances the activity of immune cells, such as natural killer cells and cytotoxic T cells, which are responsible for eliminating virus-infected cells.

Application of Recombinant Mouse Ifna15 Protein

Recombinant Mouse Ifna15 Protein has various applications in both research and medicine. In research, it is used as a tool to study the immune system and its response to viral infections. It is also used to investigate the mechanisms of action of other cytokines and their interactions with the immune system.

In medicine, Recombinant Mouse Ifna15 Protein has shown promising results in the treatment of viral infections, such as hepatitis B and C, and certain types of cancer. It has also been used in the treatment of autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis, due to its ability to modulate the immune response.

Recombinant Mouse Ifna15 Protein as an Antigen

An antigen is a substance that can elicit an immune response in the body. Recombinant Mouse Ifna15 Protein can act as an antigen when introduced into the body, triggering the production of antibodies and activating immune cells. This property is utilized in the development of vaccines, where the protein is used as an antigen to stimulate the immune system and provide protection against viral infections.

Conclusion

In summary, Recombinant Mouse Ifna15 Protein is a cytokine with a vital role in the immune system. Its ability to stimulate antiviral responses and modulate the immune system has made it a valuable tool in research and a potential therapeutic agent for various diseases. Its structure, activity, and applications make it a promising recombinant protein in the field of biotechnology and medicine.

Recombinant Mouse Ifna15 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse Ifna15 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products