Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse DAND5 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q76LW6
Molecular weight:
42.40 kDa

Original price was: $422.00.Current price is: $327.00.

100ug 23% OFF + 327 loyalty points
Ser55–Leu185
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse DAND5 Protein, N-GST & C-His

Product name ARO-P10954-100
Uniprot ID Q76LW6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SWEAFLGLQNKQQGTGELQGGGQRVAAGVPLPLAPQEVLQETCKALSFVQVISRPGCTSARVLNHLCFGRCSSFYIPSSDPTPVVFCNSCVPARKRWTSVTLWCGAGQLASPRRVRISTVLVQKCQCRPKL
Molecular weight 42.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser55-Leu185
Aliases /Synonyms DAN domain family member 5, Cerberus-like protein 2, Dand5, Cerl-2, Cerl2, Sp1
Reference ARO-P10954
Note For research use only.
Molecular Constructor
Ser55–Leu185
Product name ARO-P10954-1MG
Uniprot ID Q76LW6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SWEAFLGLQNKQQGTGELQGGGQRVAAGVPLPLAPQEVLQETCKALSFVQVISRPGCTSARVLNHLCFGRCSSFYIPSSDPTPVVFCNSCVPARKRWTSVTLWCGAGQLASPRRVRISTVLVQKCQCRPKL
Molecular weight 42.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser55-Leu185
Aliases /Synonyms DAN domain family member 5, Cerberus-like protein 2, Dand5, Cerl-2, Cerl2, Sp1
Reference ARO-P10954
Note For research use only.
Molecular Constructor
Ser55–Leu185
Product name ARO-P10954-50
Uniprot ID Q76LW6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SWEAFLGLQNKQQGTGELQGGGQRVAAGVPLPLAPQEVLQETCKALSFVQVISRPGCTSARVLNHLCFGRCSSFYIPSSDPTPVVFCNSCVPARKRWTSVTLWCGAGQLASPRRVRISTVLVQKCQCRPKL
Molecular weight 42.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser55-Leu185
Aliases /Synonyms DAN domain family member 5, Cerberus-like protein 2, Dand5, Cerl-2, Cerl2, Sp1
Reference ARO-P10954
Note For research use only.
Molecular Constructor
Ser55–Leu185

Introduction to Recombinant Mouse DAND5 Protein

Recombinant Mouse DAND5 Protein, also known as Dan domain family member 5, is a protein that is encoded by the Dand5 gene in mice. This protein belongs to the Dan family of secreted proteins and is involved in various developmental processes. Recombinant Mouse DAND5 Protein is produced through recombinant DNA technology and has a wide range of applications in the field of research and medicine.

Structure of Recombinant Mouse DAND5 Protein

Recombinant Mouse DAND5 Protein is a glycosylated protein with a molecular weight of approximately 30 kDa. It is composed of 267 amino acids and has a predicted isoelectric point of 6.8. The protein contains a conserved cysteine-rich domain, known as the Dan domain, which is essential for its function. This domain is responsible for the binding of other proteins, such as bone morphogenetic proteins (BMPs), and plays a critical role in regulating their activity.

Activity of Recombinant Mouse DAND5 Protein

Recombinant Mouse DAND5 Protein is a potent antagonist of BMP signaling. It binds to BMPs and prevents their interaction with their receptors, thereby inhibiting their downstream signaling pathways. This activity is crucial for the proper regulation of various developmental processes, such as cell differentiation, proliferation, and apoptosis. Recombinant Mouse DAND5 Protein has also been shown to play a role in the maintenance of stem cell populations and the formation of various tissues and organs.

Applications of Recombinant Mouse DAND5 Protein

Recombinant Mouse DAND5 Protein has numerous applications in both research and medicine. Its ability to antagonize BMP signaling makes it a valuable tool for studying the role of BMPs in various biological processes. It can be used in in vitro experiments to investigate the effects of BMP inhibition on cell behavior, as well as in in vivo studies to understand its role in development and disease.

In addition, Recombinant Mouse DAND5 Protein has potential therapeutic applications. Its ability to regulate BMP signaling makes it a promising candidate for the treatment of various diseases, including cancer, osteoporosis, and cardiovascular disorders. It has been shown to inhibit the growth of cancer cells by blocking the pro-proliferative effects of BMPs. Furthermore, it has been demonstrated to promote bone formation and prevent bone loss in animal models of osteoporosis.

Antigenic Properties of Recombinant Mouse DAND5 Protein

Recombinant Mouse DAND5 Protein is a highly immunogenic protein, making it an excellent antigen for antibody production. Its antigenic properties have been utilized in the development of diagnostic assays for various diseases. For example, antibodies against Recombinant Mouse DAND5 Protein have been used to detect its expression in cancer tissues, providing a potential biomarker for early detection and diagnosis.

Conclusion

Recombinant Mouse DAND5 Protein is a crucial protein involved in the regulation of BMP signaling and various developmental processes. Its recombinant form has allowed for its widespread use in research and medicine, and its potential therapeutic applications make it a promising candidate for future treatments. Its structural and functional properties make it a valuable tool for studying the role of BMPs in development and disease.

Recombinant Mouse DAND5 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse DAND5 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products