Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse IFN gamma recombinant protein

Note:
For research use only.

$392.00

100 ug + 392 loyalty points
His His23–Cys155
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse IFN gamma recombinant protein

Mouse IFN gamma recombinant protein

Product name Mouse IFN gamma recombinant protein
Uniprot ID P01580
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Molecular weight 17.82 kDa
Protein delivered with Tag? N-Terminal His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Lyophilized
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His23-Cys155
Aliases /Synonyms Immune interferon, IFNG, Interferon gamma, IFN-gamma
Reference PX-P6285
Note For research use only.
Molecular Constructor
His His23–Cys155

Mouse IFN gamma recombinant protein

There are no reviews yet.

Be the first to review “Mouse IFN gamma recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products