Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Interferon alpha

Host species:
Escherichia coli (E.coli)
Uniprot ID:
A0PA06
Molecular weight:
20.85KDa

$250.00

50ug + 250 loyalty points
Cys24–Glu186
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Interferon alpha

Interferon alpha

Product name Interferon alpha
Uniprot ID A0PA06
Uniprot link https://www.uniprot.org/uniprot/A0PA06
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGENLYFQGCDLPLTHSLVDRRALILLGQMRRISPFSCLKDREDFGFPQGVLHGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLYQQLIHLEACQTREVGAEETPLLDEDSTLAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMRSYSLSTHLKETKE
Molecular weight 20.85KDa
Purity estimated 90%
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu186
Aliases /Synonyms Interferon alpha
Reference PX-P4357
Note For research use only
Molecular Constructor
Cys24–Glu186
Product name Interferon alpha
Uniprot ID A0PA06
Uniprot link https://www.uniprot.org/uniprot/A0PA06
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGENLYFQGCDLPLTHSLVDRRALILLGQMRRISPFSCLKDREDFGFPQGVLHGNQFQEAQAIAVAHEVTRQTFLLFCTEASSAAWDETLRSRFCTGLYQQLIHLEACQTREVGAEETPLLDEDSTLAVRSYFQRLFLYLQEKKHSPCAWEIIRAEIMRSYSLSTHLKETKE
Molecular weight 20.85KDa
Purity estimated 90%
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys24-Glu186
Aliases /Synonyms Interferon alpha
Reference PX-P4357
Note For research use only
Molecular Constructor
Cys24–Glu186

There are no reviews yet.

Be the first to review “Interferon alpha”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products