Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse-ear cress CENH3 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
A. thaliana
Uniprot ID:
Q8RVQ9
Molecular weight:
39.08 kDa

Original price was: $343.00.Current price is: $274.00.

50ug 20% OFF + 274 loyalty points
Gly83–Trp178
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse-ear cress CENH3 Protein, N-GST & C-His

Product name ARO-P10237-100
Uniprot ID Q8RVQ9
Origin species A. thaliana
Expression system Prokaryotic expression
Raw Antigen Sequence GTVALKEIRHFQKQTNLLIPAASFIREVRSITHMLAPPQINRWTAEALVALQEAAEDYLVGLFSDSMLCAIHARRVTLMRKDFELARRLGGKGRPW
Molecular weight 39.08 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly83-Trp178
Aliases /Synonyms Histone H3-like centromeric protein CENH3, Centromeric histone CENH3, Centromeric histone H3, Histone H3-like centromeric protein HTR12, CENH3, HTR12, At1g01370, F6F3.17
Reference ARO-P10237
Note For research use only.
Molecular Constructor
Gly83–Trp178
Product name ARO-P10237-1MG
Uniprot ID Q8RVQ9
Origin species A. thaliana
Expression system Prokaryotic expression
Raw Antigen Sequence GTVALKEIRHFQKQTNLLIPAASFIREVRSITHMLAPPQINRWTAEALVALQEAAEDYLVGLFSDSMLCAIHARRVTLMRKDFELARRLGGKGRPW
Molecular weight 39.08 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly83-Trp178
Aliases /Synonyms Histone H3-like centromeric protein CENH3, Centromeric histone CENH3, Centromeric histone H3, Histone H3-like centromeric protein HTR12, CENH3, HTR12, At1g01370, F6F3.17
Reference ARO-P10237
Note For research use only.
Molecular Constructor
Gly83–Trp178
Product name ARO-P10237-50
Uniprot ID Q8RVQ9
Origin species A. thaliana
Expression system Prokaryotic expression
Raw Antigen Sequence GTVALKEIRHFQKQTNLLIPAASFIREVRSITHMLAPPQINRWTAEALVALQEAAEDYLVGLFSDSMLCAIHARRVTLMRKDFELARRLGGKGRPW
Molecular weight 39.08 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly83-Trp178
Aliases /Synonyms Histone H3-like centromeric protein CENH3, Centromeric histone CENH3, Centromeric histone H3, Histone H3-like centromeric protein HTR12, CENH3, HTR12, At1g01370, F6F3.17
Reference ARO-P10237
Note For research use only.
Molecular Constructor
Gly83–Trp178

There are no reviews yet.

Be the first to review “Recombinant Mouse-ear cress CENH3 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products