Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Mouse ERRFI1 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q99JZ7
Molecular weight:
35.87 kDa

Original price was: $303.00.Current price is: $271.00.

50ug 11% OFF + 271 loyalty points
GST Ser329–Arg399 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Mouse ERRFI1 Protein, N-GST & C-His

Recombinant Mouse ERRFI1 Protein, N-GST & C-His

Product name ARO-P16420-100
Uniprot ID Q99JZ7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SRTPSPKSLPSYLNGVMPPTQSFAPDPKYVSSKALQRQSSEGSANKVPCILPIIENGKKVSSTHYYLLPER
Molecular weight 35.87 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser329-Arg399
Aliases /Synonyms ERBB receptor feedback inhibitor 1, Mitogen-inducible gene 6 protein homolog, MIG-6, Errfi1, Mig6
Reference ARO-P16420
Note For research use only.
Molecular Constructor
GST Ser329–Arg399 His
Product name ARO-P16420-1MG
Uniprot ID Q99JZ7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SRTPSPKSLPSYLNGVMPPTQSFAPDPKYVSSKALQRQSSEGSANKVPCILPIIENGKKVSSTHYYLLPER
Molecular weight 35.87 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser329-Arg399
Aliases /Synonyms ERBB receptor feedback inhibitor 1, Mitogen-inducible gene 6 protein homolog, MIG-6, Errfi1, Mig6
Reference ARO-P16420
Note For research use only.
Molecular Constructor
GST Ser329–Arg399 His
Product name ARO-P16420-50
Uniprot ID Q99JZ7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SRTPSPKSLPSYLNGVMPPTQSFAPDPKYVSSKALQRQSSEGSANKVPCILPIIENGKKVSSTHYYLLPER
Molecular weight 35.87 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser329-Arg399
Aliases /Synonyms ERBB receptor feedback inhibitor 1, Mitogen-inducible gene 6 protein homolog, MIG-6, Errfi1, Mig6
Reference ARO-P16420
Note For research use only.
Molecular Constructor
GST Ser329–Arg399 His

There are no reviews yet.

Be the first to review “Recombinant Mouse ERRFI1 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products