Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse FZD5 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9EQD0
Molecular weight:
38.51 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Thr37–Ala126
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse FZD5 Protein, N-GST & C-His

Product name ARO-P10469-100
Uniprot ID Q9EQD0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFA
Molecular weight 38.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr37-Ala126
Aliases /Synonyms Frizzled-5, FzE5, C2orf31, hFz5, FZD5, Fz-5
Reference ARO-P10469
Note For research use only.
Molecular Constructor
Thr37–Ala126
Product name ARO-P10469-1MG
Uniprot ID Q9EQD0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFA
Molecular weight 38.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr37-Ala126
Aliases /Synonyms Frizzled-5, FzE5, C2orf31, hFz5, FZD5, Fz-5
Reference ARO-P10469
Note For research use only.
Molecular Constructor
Thr37–Ala126
Product name ARO-P10469-50
Uniprot ID Q9EQD0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFA
Molecular weight 38.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr37-Ala126
Aliases /Synonyms Frizzled-5, FzE5, C2orf31, hFz5, FZD5, Fz-5
Reference ARO-P10469
Note For research use only.
Molecular Constructor
Thr37–Ala126

Introduction

Recombinant proteins have become an essential tool in the field of molecular biology, allowing for the production of large quantities of specific proteins for various research and therapeutic purposes. One such protein is the Recombinant Mouse FZD5 Protein, which has gained significant attention due to its structural and functional importance in various cellular processes. In this article, we will explore the structure, activity, and application of this protein in detail.

Structure of Recombinant Mouse FZD5 Protein

The FZD5 (Frizzled-5) protein is a member of the Frizzled family of seven-transmembrane domain receptors, which are involved in the Wnt signaling pathway. The Recombinant Mouse FZD5 Protein is a synthetic version of the mouse FZD5 gene, produced through recombinant DNA technology. It consists of 534 amino acids and has a molecular weight of approximately 60 kDa.

The protein structure of FZD5 consists of an extracellular N-terminal cysteine-rich domain, followed by seven transmembrane domains, and an intracellular C-terminal domain. The extracellular domain contains ten conserved cysteine residues, which form disulfide bonds and are essential for protein stability and ligand binding. The transmembrane domains are responsible for receptor activation and signal transduction, while the intracellular domain interacts with downstream signaling molecules.

Activity of Recombinant Mouse FZD5 Protein

The primary function of FZD5 is to act as a receptor for the Wnt family of secreted glycoproteins. Upon binding of Wnt ligands, FZD5 undergoes conformational changes and forms a complex with co-receptors, such as LRP5/6, leading to the activation of downstream signaling pathways. This, in turn, regulates various cellular processes, including cell proliferation, differentiation, and migration.

Studies have shown that FZD5 is highly expressed in various tissues, including the brain, heart, and skeletal muscles, indicating its crucial role in development and homeostasis. It has also been implicated in several diseases, such as cancer, where aberrant Wnt signaling through FZD5 can lead to uncontrolled cell growth and tumor progression.

Application of Recombinant Mouse FZD5 Protein

The availability of Recombinant Mouse FZD5 Protein has opened up new avenues for research in the field of Wnt signaling. It has been widely used in in vitro and in vivo studies to understand the role of FZD5 in various cellular processes and disease states. The protein has also been used in drug discovery and development, with several small molecule inhibitors targeting FZD5 currently in clinical trials for cancer treatment.

Furthermore, Recombinant Mouse FZD5 Protein has been utilized in structural studies, such as X-ray crystallography and nuclear magnetic resonance spectroscopy, to determine the three-dimensional structure of the protein and its interaction with ligands. This information can aid in the design of more potent and specific inhibitors for therapeutic purposes.

Conclusion

In summary, Recombinant Mouse FZD5 Protein is a valuable tool for understanding the structure, activity, and function of this important receptor in the Wnt signaling pathway. Its availability has paved the way for groundbreaking research and potential therapeutic interventions in various diseases. With ongoing advancements in recombinant protein technology, the use of Recombinant Mouse FZD5 Protein is expected to continue to expand and contribute to the understanding of this critical signaling pathway.

Recombinant Mouse FZD5 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse FZD5 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products