Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ASAH2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9JHE3
Molecular weight:
15.77 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
Glu641–Thr756
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ASAH2 Protein, N-His

Product name ARO-P11041-100
Uniprot ID Q9JHE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EYRVGEVVEVIFVGANPKNSAENQTHQTFLTVEKYEDSVADWQIMYNDASWETRFYWHKGILGLSNATIYWHIPDTAYPGIYRIRYFGHNRKQELLKPAVILAFEGISSPFEVVTT
Molecular weight 15.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu641-Thr756
Aliases /Synonyms Acylsphingosine deacylase 2, Neutral ceramidase, NCDase, N-acylsphingosine amidohydrolase 2, Asah2, N-CDase
Reference ARO-P11041
Note For research use only.
Molecular Constructor
Glu641–Thr756
Product name ARO-P11041-1MG
Uniprot ID Q9JHE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EYRVGEVVEVIFVGANPKNSAENQTHQTFLTVEKYEDSVADWQIMYNDASWETRFYWHKGILGLSNATIYWHIPDTAYPGIYRIRYFGHNRKQELLKPAVILAFEGISSPFEVVTT
Molecular weight 15.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu641-Thr756
Aliases /Synonyms Acylsphingosine deacylase 2, Neutral ceramidase, NCDase, N-acylsphingosine amidohydrolase 2, Asah2, N-CDase
Reference ARO-P11041
Note For research use only.
Molecular Constructor
Glu641–Thr756
Product name ARO-P11041-50
Uniprot ID Q9JHE3
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EYRVGEVVEVIFVGANPKNSAENQTHQTFLTVEKYEDSVADWQIMYNDASWETRFYWHKGILGLSNATIYWHIPDTAYPGIYRIRYFGHNRKQELLKPAVILAFEGISSPFEVVTT
Molecular weight 15.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu641-Thr756
Aliases /Synonyms Acylsphingosine deacylase 2, Neutral ceramidase, NCDase, N-acylsphingosine amidohydrolase 2, Asah2, N-CDase
Reference ARO-P11041
Note For research use only.
Molecular Constructor
Glu641–Thr756

Introduction to Recombinant Mouse ASAH2 Protein

Recombinant Mouse ASAH2 Protein, also known as Acid Ceramidase 2, is a highly specialized protein that plays a crucial role in the metabolism of sphingolipids. It is encoded by the ASAH2 gene and is a member of the acid ceramidase family. This protein is expressed in various tissues and has been extensively studied for its structure, activity, and potential applications in various fields of research.

Structure of Recombinant Mouse ASAH2 Protein

The recombinant form of this protein is produced by cloning the ASAH2 gene into a suitable expression vector and expressing it in a host organism such as E. coli or yeast. The resulting protein has a molecular weight of approximately 50 kDa and consists of 453 amino acids. It has a conserved catalytic domain and a hydrophobic N-terminal region that serves as a signal peptide for targeting the protein to the lysosomes.

The crystal structure of recombinant mouse ASAH2 protein has been determined, revealing a homodimeric structure with each monomer consisting of six alpha-helices and eight beta-strands. The active site of the protein is located at the interface of the two monomers and contains a zinc ion that is essential for its catalytic activity.

Activity of Recombinant Mouse ASAH2 Protein

Recombinant Mouse ASAH2 Protein is a lysosomal enzyme that catalyzes the hydrolysis of ceramide into sphingosine and fatty acid. This activity is crucial for maintaining the balance of sphingolipids in the cell and plays a role in various physiological processes such as cell growth, differentiation, and apoptosis.

Studies have shown that mutations in the ASAH2 gene can lead to a deficiency in ASAH2 protein activity, resulting in an accumulation of ceramide in lysosomes. This has been linked to various diseases such as Farber disease and spinal muscular atrophy with progressive myoclonic epilepsy.

Applications of Recombinant Mouse ASAH2 Protein

Recombinant Mouse ASAH2 Protein has various potential applications in both basic research and clinical settings. Its role in sphingolipid metabolism makes it a valuable tool for studying the effects of ceramide on cellular processes. It can also be used to investigate the role of ASAH2 in diseases associated with sphingolipid abnormalities.

Furthermore, the recombinant protein has shown promise as a therapeutic agent for the treatment of diseases such as cancer and neurodegenerative disorders. Studies have demonstrated that ASAH2 can inhibit the growth of cancer cells and promote neuronal survival, making it a potential target for drug development.

Conclusion

Recombinant Mouse ASAH2 Protein is a highly specialized protein with a crucial role in sphingolipid metabolism. Its structure and activity have been extensively studied, and it has shown potential for various applications in research and medicine. Further studies on this protein may lead to a better understanding of its functions and potential therapeutic uses.

Keywords: Recombinant protein, antigen, ASAH2, acid ceramidase, sphingolipids, lysosomal enzyme, catalytic activity, structure, applications.

Recombinant Mouse ASAH2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ASAH2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products