Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ASGR1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P34927
Molecular weight:
17.52 kDa

Original price was: $320.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
Asn156–Asn284
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ASGR1 Protein, N-His

Product name ARO-P10589-100
Uniprot ID P34927
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Molecular weight 17.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn156-Asn284
Aliases /Synonyms HL-1, ASGP-R 1, Asialoglycoprotein receptor 1, CLEC4H1, ASGR1, C-type lectin domain family 4 member H1, ASGPR 1, Hepatic lectin H1
Reference ARO-P10589
Note For research use only.
Molecular Constructor
Asn156–Asn284
Product name ARO-P10589-1MG
Uniprot ID P34927
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Molecular weight 17.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn156-Asn284
Aliases /Synonyms HL-1, ASGP-R 1, Asialoglycoprotein receptor 1, CLEC4H1, ASGR1, C-type lectin domain family 4 member H1, ASGPR 1, Hepatic lectin H1
Reference ARO-P10589
Note For research use only.
Molecular Constructor
Asn156–Asn284
Product name ARO-P10589-50
Uniprot ID P34927
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence NWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Molecular weight 17.52 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn156-Asn284
Aliases /Synonyms HL-1, ASGP-R 1, Asialoglycoprotein receptor 1, CLEC4H1, ASGR1, C-type lectin domain family 4 member H1, ASGPR 1, Hepatic lectin H1
Reference ARO-P10589
Note For research use only.
Molecular Constructor
Asn156–Asn284

Introduction

Recombinant Mouse ASGR1 Protein, also known as Asialoglycoprotein Receptor 1, is a transmembrane protein that is involved in the recognition and uptake of glycoproteins by liver cells. It is a member of the C-type lectin family and is highly expressed in hepatocytes. Recombinant Mouse ASGR1 Protein is commonly used in research and therapeutic applications due to its unique structure and function.

Structure of Recombinant Mouse ASGR1 Protein

Recombinant Mouse ASGR1 Protein is composed of two subunits, alpha and beta, which are linked by disulfide bonds. The alpha subunit is responsible for ligand binding, while the beta subunit is involved in signal transduction. The alpha subunit contains a carbohydrate recognition domain (CRD) that specifically binds to terminal galactose and N-acetylgalactosamine residues on glycoproteins. This CRD is highly conserved among species, making Recombinant Mouse ASGR1 Protein an ideal model for studying ligand binding and specificity.

Activity of Recombinant Mouse ASGR1 Protein

The main function of Recombinant Mouse ASGR1 Protein is to mediate the endocytosis of glycoproteins, particularly those containing galactose and N-acetylgalactosamine residues. This process involves the binding of the CRD of Recombinant Mouse ASGR1 Protein to the glycoprotein, followed by internalization and degradation of the complex. This activity is essential for the clearance of circulating glycoproteins and plays a crucial role in maintaining homeostasis in the body.

In addition to its role in glycoprotein uptake, Recombinant Mouse ASGR1 Protein has also been shown to play a role in cell adhesion and migration. It has been found to interact with other cell surface receptors and signaling molecules, suggesting a potential role in cell signaling pathways.

Applications of Recombinant Mouse ASGR1 Protein

Recombinant Mouse ASGR1 Protein has a wide range of applications in both research and therapeutics. Its ability to specifically bind and internalize glycoproteins makes it a valuable tool for studying protein trafficking and clearance mechanisms. This has led to its use in various studies related to liver diseases, such as viral hepatitis and liver fibrosis.

In addition, Recombinant Mouse ASGR1 Protein has been used in the development of targeted drug delivery systems. By conjugating drugs or therapeutic molecules to glycoproteins recognized by Recombinant Mouse ASGR1 Protein, researchers have been able to specifically target liver cells and deliver treatments directly to the site of disease.

Furthermore, Recombinant Mouse ASGR1 Protein has shown potential as a biomarker for liver diseases. Its expression has been found to be altered in various liver pathologies, making it a potential diagnostic and prognostic tool.

Conclusion

In summary, Recombinant Mouse ASGR1 Protein is a highly specialized transmembrane protein that plays a crucial role in the recognition and uptake of glycoproteins by liver cells. Its unique structure and function make it a valuable tool for research and therapeutic applications. With ongoing studies and advancements in technology, the potential uses of Recombinant Mouse ASGR1 Protein are continuously expanding, making it an important protein in the field of biomedicine.

Recombinant Mouse ASGR1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ASGR1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products