Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse IgA1/IGHA1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P01878
Molecular weight:
13.87 kDa

Original price was: $328.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Pro219–Asp321
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse IgA1/IGHA1 Protein, N-His

Product name ARO-P10617-100
Uniprot ID P01878
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PQVHLLPPPSEELALNELLSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAETWKQGDQYSCMVGHEALPMNFTQKTID
Molecular weight 13.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro219-Asp321
Aliases /Synonyms Immunoglobulin heavy constant alpha 1, Ig alpha-1 chain C region, Ig alpha-1 chain C region TRO, Ig alpha-1 chain C region BUR, IGHA1
Reference ARO-P10617
Note For research use only.
Molecular Constructor
Pro219–Asp321
Product name ARO-P10617-1MG
Uniprot ID P01878
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PQVHLLPPPSEELALNELLSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAETWKQGDQYSCMVGHEALPMNFTQKTID
Molecular weight 13.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro219-Asp321
Aliases /Synonyms Immunoglobulin heavy constant alpha 1, Ig alpha-1 chain C region, Ig alpha-1 chain C region TRO, Ig alpha-1 chain C region BUR, IGHA1
Reference ARO-P10617
Note For research use only.
Molecular Constructor
Pro219–Asp321
Product name ARO-P10617-50
Uniprot ID P01878
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence PQVHLLPPPSEELALNELLSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAETWKQGDQYSCMVGHEALPMNFTQKTID
Molecular weight 13.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro219-Asp321
Aliases /Synonyms Immunoglobulin heavy constant alpha 1, Ig alpha-1 chain C region, Ig alpha-1 chain C region TRO, Ig alpha-1 chain C region BUR, IGHA1
Reference ARO-P10617
Note For research use only.
Molecular Constructor
Pro219–Asp321

Recombinant Mouse IgA1/IGHA1 Protein: Structure, Activity, and Applications

Introduction

Recombinant proteins have revolutionized the field of biotechnology and have become essential tools in various research and clinical applications. Recombinant Mouse IgA1/IGHA1 Protein is a highly versatile protein that has gained significant interest due to its unique structure and diverse functions. In this article, we will discuss the structure, activity, and applications of this recombinant protein in detail.

Structure of Recombinant Mouse IgA1/IGHA1 Protein

Recombinant Mouse IgA1/IGHA1 Protein is a glycoprotein consisting of two heavy chains and two light chains. The heavy chains are composed of four constant domains (Cα1, Cα2, Cα3, and Cα4) and one variable domain (Vα). The light chains, on the other hand, consist of one constant domain (Cκ) and one variable domain (Vκ). The heavy and light chains are held together by disulfide bonds, forming a Y-shaped structure.

One of the most unique features of IgA1 is the presence of a hinge region between the Cα1 and Cα2 domains. This hinge region contains multiple O-glycosylation sites, which are important for the stability and function of the protein. Recombinant Mouse IgA1/IGHA1 Protein also contains a secretory component, which is attached to the Cα3 domain and plays a crucial role in the transport of the protein across mucosal epithelial cells.

Activity of Recombinant Mouse IgA1/IGHA1 Protein

Recombinant Mouse IgA1/IGHA1 Protein is a major component of the mucosal immune system and plays a critical role in protecting the body against various pathogens. It is the most abundant antibody isotype found in mucosal secretions, such as saliva, tears, and breast milk. The main function of IgA1 is to neutralize and eliminate pathogens by binding to their surface antigens.

In addition to its role in the immune system, IgA1 also has anti-inflammatory properties. It can bind to and neutralize pro-inflammatory molecules, thereby reducing inflammation in the body. This activity of IgA1 has been studied extensively in the context of autoimmune diseases, such as rheumatoid arthritis and lupus.

Applications of Recombinant Mouse IgA1/IGHA1 Protein

Recombinant Mouse IgA1/IGHA1 Protein has a wide range of applications in research and clinical settings. One of its primary uses is in the production of monoclonal antibodies. Monoclonal antibodies are highly specific and can be used for various diagnostic and therapeutic purposes. Recombinant Mouse IgA1/IGHA1 Protein can be genetically engineered to produce specific monoclonal antibodies against a particular antigen.

Another important application of Recombinant Mouse IgA1/IGHA1 Protein is in the development of mucosal vaccines. As IgA1 is the predominant antibody isotype in mucosal secretions, it is an ideal candidate for mucosal vaccination. Recombinant Mouse IgA1/IGHA1 Protein can be used to produce recombinant vaccines against various pathogens, including viruses, bacteria, and parasites.

Furthermore, Recombinant Mouse IgA1/IGHA1 Protein has potential therapeutic applications in the treatment of autoimmune diseases and inflammatory disorders. Its anti-inflammatory properties make it a promising candidate for the development of novel treatments for these conditions.

Conclusion

In summary, Recombinant

Recombinant Mouse IgA1/IGHA1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse IgA1/IGHA1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products