Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse IL20RB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
E9Q9A6
Molecular weight:
23.60 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Ser37–Ser225
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse IL20RB Protein, N-His

Product name ARO-P11005-100
Uniprot ID E9Q9A6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SVQSTNMKHLLMWNPVTQPGETVLYCVEYQGEYESLYMSHIWIPSSQCSPTKSLECDVTDDITATVPYNFRVKAMLGSQTSAWSNLEHPFNRNATVLTPPRMEVTEHGLHLVIELEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKAQALVKAIGRHSAFSQPTCVEMQGES
Molecular weight 23.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser37-Ser225
Aliases /Synonyms IL-20R-beta, IL-20R2, FNDC6, IL-20RB, DIRS1, IL20RB, Interleukin-20 receptor subunit beta, Fibronectin type III domain containing 6, IL-20 receptor subunit beta
Reference ARO-P11005
Note For research use only.
Molecular Constructor
Ser37–Ser225
Product name ARO-P11005-1MG
Uniprot ID E9Q9A6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SVQSTNMKHLLMWNPVTQPGETVLYCVEYQGEYESLYMSHIWIPSSQCSPTKSLECDVTDDITATVPYNFRVKAMLGSQTSAWSNLEHPFNRNATVLTPPRMEVTEHGLHLVIELEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKAQALVKAIGRHSAFSQPTCVEMQGES
Molecular weight 23.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser37-Ser225
Aliases /Synonyms IL-20R-beta, IL-20R2, FNDC6, IL-20RB, DIRS1, IL20RB, Interleukin-20 receptor subunit beta, Fibronectin type III domain containing 6, IL-20 receptor subunit beta
Reference ARO-P11005
Note For research use only.
Molecular Constructor
Ser37–Ser225
Product name ARO-P11005-50
Uniprot ID E9Q9A6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SVQSTNMKHLLMWNPVTQPGETVLYCVEYQGEYESLYMSHIWIPSSQCSPTKSLECDVTDDITATVPYNFRVKAMLGSQTSAWSNLEHPFNRNATVLTPPRMEVTEHGLHLVIELEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKAQALVKAIGRHSAFSQPTCVEMQGES
Molecular weight 23.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser37-Ser225
Aliases /Synonyms IL-20R-beta, IL-20R2, FNDC6, IL-20RB, DIRS1, IL20RB, Interleukin-20 receptor subunit beta, Fibronectin type III domain containing 6, IL-20 receptor subunit beta
Reference ARO-P11005
Note For research use only.
Molecular Constructor
Ser37–Ser225

Recombinant Mouse IL20RB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse IL20RB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products