Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse NODAL Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P43021
Molecular weight:
20.93 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Ser40–Asn203
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse NODAL Protein, N-His

Product name ARO-P11049-100
Uniprot ID P43021
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPLAYMLSLYRDPLPRADIIRSLQAQDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLPGPMDIPTEGPLTIDIFHQAKGDPERDPADCLERIWMETFTVIPSQVTFASGSTVLEVTKPLSKWLKDPRALEKQVSSRAEKCWHQPYTPPVPVASTNVLMLYSN
Molecular weight 20.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser40-Asn203
Aliases /Synonyms Nodal
Reference ARO-P11049
Note For research use only.
Molecular Constructor
Ser40–Asn203
Product name ARO-P11049-1MG
Uniprot ID P43021
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPLAYMLSLYRDPLPRADIIRSLQAQDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLPGPMDIPTEGPLTIDIFHQAKGDPERDPADCLERIWMETFTVIPSQVTFASGSTVLEVTKPLSKWLKDPRALEKQVSSRAEKCWHQPYTPPVPVASTNVLMLYSN
Molecular weight 20.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser40-Asn203
Aliases /Synonyms Nodal
Reference ARO-P11049
Note For research use only.
Molecular Constructor
Ser40–Asn203
Product name ARO-P11049-50
Uniprot ID P43021
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPLAYMLSLYRDPLPRADIIRSLQAQDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLPGPMDIPTEGPLTIDIFHQAKGDPERDPADCLERIWMETFTVIPSQVTFASGSTVLEVTKPLSKWLKDPRALEKQVSSRAEKCWHQPYTPPVPVASTNVLMLYSN
Molecular weight 20.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser40-Asn203
Aliases /Synonyms Nodal
Reference ARO-P11049
Note For research use only.
Molecular Constructor
Ser40–Asn203

Introduction

Recombinant proteins have become a valuable tool in the field of molecular biology and biotechnology. These proteins are synthesized in vitro using recombinant DNA technology, allowing for the production of large quantities of pure and highly specific proteins. One such protein is Recombinant Mouse NODAL Protein, which has gained significant attention for its role in embryonic development and stem cell research. In this article, we will explore the structure, activity, and application of this important protein.

Structure of Recombinant Mouse NODAL Protein

Recombinant Mouse NODAL Protein is a member of the transforming growth factor-beta (TGF-β) superfamily of proteins. It is a homodimeric protein, meaning it is composed of two identical subunits, each with a molecular weight of approximately 35 kDa. The protein is highly conserved among different species, with the mouse and human versions sharing 100% amino acid sequence identity.

The primary structure of Recombinant Mouse NODAL Protein consists of 347 amino acids, with a signal peptide at the N-terminus and a propeptide at the C-terminus. The mature protein is composed of 110 amino acids and has a predicted molecular weight of 12.5 kDa. The crystal structure of Recombinant Mouse NODAL Protein has been determined, revealing a compact globular structure with a central hydrophobic core.

Activity of Recombinant Mouse NODAL Protein

Recombinant Mouse NODAL Protein is a potent signaling molecule involved in embryonic development and stem cell maintenance. It is primarily expressed in the primitive streak and node of the developing embryo, where it plays a crucial role in establishing the anterior-posterior axis. NODAL signaling is also essential for the formation of the mesoderm and endoderm, which give rise to various tissues and organs in the developing embryo.

The activity of Recombinant Mouse NODAL Protein is mediated by its interaction with type I and type II serine/threonine kinase receptors, including ALK4, ALK7, and ActRIIA. Upon binding to its receptors, NODAL activates the Smad2/3 signaling pathway, leading to the transcription of target genes involved in cell fate determination and differentiation. NODAL signaling is tightly regulated, and dysregulation of this pathway has been linked to developmental defects and diseases, including cancer.

Application of Recombinant Mouse NODAL Protein

Recombinant Mouse NODAL Protein has a wide range of applications in both basic research and clinical settings. In developmental biology, this protein is used to study the role of NODAL signaling in embryonic development and stem cell differentiation. It is also a valuable tool for investigating the mechanisms of NODAL-related diseases and developing potential therapeutic interventions.

In stem cell research, Recombinant Mouse NODAL Protein is used to maintain the pluripotency of embryonic stem cells and induce their differentiation into specific cell types. It has also been shown to enhance the differentiation of mesenchymal stem cells into cardiomyocytes, making it a potential candidate for cardiac tissue engineering.

In addition to its research applications, Recombinant Mouse NODAL Protein has potential clinical applications. It has been shown to promote bone formation and enhance fracture healing in animal models, making it a promising candidate for bone tissue engineering. Furthermore, NODAL signaling has been implicated in various cancers, and Recombinant Mouse NODAL Protein may serve as a potential target for cancer therapy.

Conclusion

Recombinant Mouse NODAL Protein is a versatile protein with important roles in embryonic development and stem cell maintenance. Its well-defined structure and potent signaling activity make it a valuable tool for studying developmental processes and diseases. With its potential applications in both basic research and clinical settings, this protein continues to be a subject of interest for scientists and clinicians alike.

Recombinant Mouse NODAL Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse NODAL Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products