Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse EGFLAM Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q4VBE4
Molecular weight:
24.06 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Asp40–Thr236
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse EGFLAM Protein, N-His

Product name ARO-P11051-100
Uniprot ID Q4VBE4
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DIKLGALNCTAFSIQWKTPKRSGSSIIGYTVFYSEVGSDKSLRERSHNVPVGQDTLITEEVIGDLKPGTEYQVSVAAYSQTGKGRLSFPRHVTTLSQDSCLPPAAPQQPHVLVVSDSEVALSWRPGENEGSAPIQSYSVEFIRPDFDKSWTIIQERLQMDSMVIKGLDPDTNYQFAVKAMNAHGFSPRSWPSNTVRT
Molecular weight 24.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Thr236
Aliases /Synonyms Pikachurin, Nectican, EGF-like, fibronectin type-III and laminin G-like domain-containing protein, Egflam
Reference ARO-P11051
Note For research use only.
Molecular Constructor
Asp40–Thr236
Product name ARO-P11051-1MG
Uniprot ID Q4VBE4
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DIKLGALNCTAFSIQWKTPKRSGSSIIGYTVFYSEVGSDKSLRERSHNVPVGQDTLITEEVIGDLKPGTEYQVSVAAYSQTGKGRLSFPRHVTTLSQDSCLPPAAPQQPHVLVVSDSEVALSWRPGENEGSAPIQSYSVEFIRPDFDKSWTIIQERLQMDSMVIKGLDPDTNYQFAVKAMNAHGFSPRSWPSNTVRT
Molecular weight 24.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Thr236
Aliases /Synonyms Pikachurin, Nectican, EGF-like, fibronectin type-III and laminin G-like domain-containing protein, Egflam
Reference ARO-P11051
Note For research use only.
Molecular Constructor
Asp40–Thr236
Product name ARO-P11051-50
Uniprot ID Q4VBE4
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence DIKLGALNCTAFSIQWKTPKRSGSSIIGYTVFYSEVGSDKSLRERSHNVPVGQDTLITEEVIGDLKPGTEYQVSVAAYSQTGKGRLSFPRHVTTLSQDSCLPPAAPQQPHVLVVSDSEVALSWRPGENEGSAPIQSYSVEFIRPDFDKSWTIIQERLQMDSMVIKGLDPDTNYQFAVKAMNAHGFSPRSWPSNTVRT
Molecular weight 24.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Thr236
Aliases /Synonyms Pikachurin, Nectican, EGF-like, fibronectin type-III and laminin G-like domain-containing protein, Egflam
Reference ARO-P11051
Note For research use only.
Molecular Constructor
Asp40–Thr236

Introduction

Recombinant Mouse EGFLAM Protein, also known as Epidermal Growth Factor-like and LamG Domain-containing protein, is a protein that plays a crucial role in various biological processes such as cell proliferation, migration, and differentiation. This protein is produced through recombinant DNA technology, making it a valuable tool for scientific research and medical applications. In this article, we will explore the structure, activity, and applications of Recombinant Mouse EGFLAM Protein.

Structure of Recombinant Mouse EGFLAM Protein

Recombinant Mouse EGFLAM Protein is a 56 kDa glycoprotein consisting of 508 amino acids. It contains a signal peptide, an EGF-like domain, and a LamG domain. The EGF-like domain is responsible for binding to the epidermal growth factor receptor (EGFR), while the LamG domain is involved in cell adhesion and migration.

The recombinant protein is produced by cloning the gene encoding for Mouse EGFLAM into a suitable expression vector, such as a bacterial or mammalian expression system. The protein is then expressed and purified to obtain a highly pure and active form of the protein.

Activity of Recombinant Mouse EGFLAM Protein

Recombinant Mouse EGFLAM Protein has been shown to enhance cell proliferation and migration through its interaction with EGFR. It has also been reported to promote angiogenesis, the formation of new blood vessels, by stimulating the proliferation and migration of endothelial cells.

Furthermore, studies have shown that Recombinant Mouse EGFLAM Protein can induce differentiation of stem cells into neuronal cells, suggesting its potential in regenerative medicine and tissue engineering.

In addition to its role in cellular processes, Recombinant Mouse EGFLAM Protein has also been found to play a crucial role in diseases such as cancer. It has been shown to be overexpressed in various types of cancer, including breast, lung, and colorectal cancer. This overexpression has been linked to increased cell proliferation and migration, making it a potential target for cancer therapy.

Applications of Recombinant Mouse EGFLAM Protein

Recombinant Mouse EGFLAM Protein has a wide range of applications in both research and medical fields. Its ability to promote cell proliferation and migration makes it a valuable tool for studying various cellular processes in vitro. It can also be used to induce differentiation of stem cells into specific cell types, providing a potential source for tissue regeneration.

In cancer research, Recombinant Mouse EGFLAM Protein can be used to study the mechanisms of cancer development and progression. It can also serve as a potential therapeutic target for cancer treatment, either by inhibiting its activity or using it as a drug delivery vehicle.

Moreover, Recombinant Mouse EGFLAM Protein has been investigated for its potential in promoting wound healing and tissue repair. Its ability to stimulate angiogenesis and cell migration makes it a promising candidate for developing treatments for chronic wounds and tissue damage.

Conclusion

In summary, Recombinant Mouse EGFLAM Protein is a multifunctional protein with diverse roles in various biological processes. Its structure, activity, and potential applications make it a valuable tool for scientific research and medical applications. Further studies on this protein could lead to new insights into its functions and potential therapeutic applications.

Recombinant Mouse EGFLAM Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse EGFLAM Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products