Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse RAET1E Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9CZQ6
Molecular weight:
21.65 kDa

Original price was: $343.00.Current price is: $274.00.

50ug 20% OFF + 274 loyalty points
Ser34–Lys202
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse RAET1E Protein, N-His

Product name ARO-P11024-100
Uniprot ID Q9CZQ6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMANATGKCLTQPLNDLCQELRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLVQQLKYFIPQCRQKIDEFLKQSKEK
Molecular weight 21.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser34-Lys202
Aliases /Synonyms Retinoic acid early-inducible protein 1-epsilon, RAE-1-epsilon, Raet1e
Reference ARO-P11024
Note For research use only.
Molecular Constructor
Ser34–Lys202
Product name ARO-P11024-1MG
Uniprot ID Q9CZQ6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMANATGKCLTQPLNDLCQELRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLVQQLKYFIPQCRQKIDEFLKQSKEK
Molecular weight 21.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser34-Lys202
Aliases /Synonyms Retinoic acid early-inducible protein 1-epsilon, RAE-1-epsilon, Raet1e
Reference ARO-P11024
Note For research use only.
Molecular Constructor
Ser34–Lys202
Product name ARO-P11024-50
Uniprot ID Q9CZQ6
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMANATGKCLTQPLNDLCQELRDKVSNTKVDTHKTNGYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLVQQLKYFIPQCRQKIDEFLKQSKEK
Molecular weight 21.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser34-Lys202
Aliases /Synonyms Retinoic acid early-inducible protein 1-epsilon, RAE-1-epsilon, Raet1e
Reference ARO-P11024
Note For research use only.
Molecular Constructor
Ser34–Lys202

Introduction

Recombinant Mouse RAET1E Protein is a type of recombinant protein that has been produced through genetic engineering techniques. This protein belongs to the RAET1 family, which consists of cell surface glycoproteins that play important roles in the immune system. In this article, we will discuss the structure, activity, and application of Recombinant Mouse RAET1E Protein.

Structure of Recombinant Mouse RAET1E Protein

Recombinant Mouse RAET1E Protein is a 40 kDa protein that is composed of 366 amino acids. It is a type I transmembrane protein, which means that it spans the cell membrane and has a cytoplasmic tail. The extracellular domain of this protein contains a highly conserved MHC class I-like domain, which is responsible for its interaction with immune cells. The cytoplasmic tail contains a conserved YXXM motif, which is important for signaling and internalization of the protein.

Activity of Recombinant Mouse RAET1E Protein

Recombinant Mouse RAET1E Protein is a ligand for the activating receptor NKG2D, which is expressed on natural killer (NK) cells, γδ T cells, and CD8+ αβ T cells. This protein is also a ligand for the inhibitory receptor CD94/NKG2A, which is expressed on NK cells and some T cells. The binding of Recombinant Mouse RAET1E Protein to NKG2D results in the activation of NK cells and T cells, leading to their cytotoxic activity against infected or transformed cells. On the other hand, the binding of this protein to CD94/NKG2A inhibits the cytotoxic activity of NK cells and T cells, providing a balance between immune activation and suppression.

Application of Recombinant Mouse RAET1E Protein

Recombinant Mouse RAET1E Protein has several applications in the field of immunology. One of its main applications is in cancer immunotherapy. Many tumor cells overexpress Recombinant Mouse RAET1E Protein, which makes them more susceptible to recognition and killing by NK cells and T cells. Therefore, Recombinant Mouse RAET1E Protein can be used as a therapeutic agent to enhance the immune response against cancer cells.

Another application of Recombinant Mouse RAET1E Protein is in the treatment of viral infections. Some viruses, such as cytomegalovirus, have developed mechanisms to downregulate the expression of MHC class I molecules on infected cells, making them less visible to the immune system. In this case, Recombinant Mouse RAET1E Protein can act as a surrogate ligand for NKG2D, allowing NK cells and T cells to recognize and eliminate these infected cells.

Recombinant Mouse RAET1E Protein also has potential applications in autoimmune diseases. In some autoimmune diseases, such as type 1 diabetes and rheumatoid arthritis, there is an imbalance between immune activation and suppression. Recombinant Mouse RAET1E Protein can be used to modulate this imbalance by either activating or inhibiting immune cells, depending on the specific disease.

Conclusion

In conclusion, Recombinant Mouse RAET1E Protein is a 40 kDa protein that belongs to the RAET1 family. It has a structured extracellular domain and a cytoplasmic tail, which are important for its interaction with immune cells. This protein acts as a ligand for the activating receptor NKG2D and the inhibitory receptor CD94/NKG2A, and its binding to these receptors has important implications in cancer immunotherapy, viral infections, and autoimmune diseases. Further research on Recombinant Mouse RAET1E Protein may lead to the development of novel therapies for these conditions.

Recombinant Mouse RAET1E Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse RAET1E Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products