Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse RGMB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q7TQ33
Molecular weight:
29.66 kDa

Original price was: $350.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
Gly156–Arg404
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse RGMB Protein, N-His

Product name ARO-P11054-100
Uniprot ID Q7TQ33
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPR
Molecular weight 29.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly156-Arg404
Aliases /Synonyms DRG11-responsive axonal guidance and outgrowth of neurite, DRAGON, Rgmb, Repulsive guidance molecule B
Reference ARO-P11054
Note For research use only.
Molecular Constructor
Gly156–Arg404
Product name ARO-P11054-1MG
Uniprot ID Q7TQ33
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPR
Molecular weight 29.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly156-Arg404
Aliases /Synonyms DRG11-responsive axonal guidance and outgrowth of neurite, DRAGON, Rgmb, Repulsive guidance molecule B
Reference ARO-P11054
Note For research use only.
Molecular Constructor
Gly156–Arg404
Product name ARO-P11054-50
Uniprot ID Q7TQ33
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPR
Molecular weight 29.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly156-Arg404
Aliases /Synonyms DRG11-responsive axonal guidance and outgrowth of neurite, DRAGON, Rgmb, Repulsive guidance molecule B
Reference ARO-P11054
Note For research use only.
Molecular Constructor
Gly156–Arg404

Introduction

Recombinant Mouse RGMB Protein is a highly versatile and biologically active protein that has been extensively studied for its potential therapeutic applications. This protein is a member of the repulsive guidance molecule (RGM) family, which plays a crucial role in axon guidance, neural development, and immune response. In this article, we will explore the structure, activity, and potential applications of Recombinant Mouse RGMB Protein.

Structure of Recombinant Mouse RGMB Protein

Recombinant Mouse RGMB Protein is a 49 kDa glycosylated protein that is composed of 424 amino acids. It contains a signal peptide, a von Willebrand factor type D domain, a C-terminal RGD motif, and a C-terminal region rich in cysteine residues. The protein is expressed in various tissues, including the brain, spinal cord, and immune cells.

Function and Activity of Recombinant Mouse RGMB Protein

Recombinant Mouse RGMB Protein has been shown to have diverse functions in various biological processes. One of its main functions is to act as a repulsive guidance molecule for axon guidance during neural development. It interacts with the Neogenin receptor to regulate the growth and guidance of axons, which is essential for the proper development of the nervous system.

In addition to its role in axon guidance, Recombinant Mouse RGMB Protein also plays a crucial role in immune response. It has been shown to modulate the activation and differentiation of immune cells, such as T cells, B cells, and macrophages. This protein also has anti-inflammatory properties and can regulate the production of pro-inflammatory cytokines, making it a potential therapeutic target for inflammatory diseases.

Applications of Recombinant Mouse RGMB Protein

Due to its diverse functions, Recombinant Mouse RGMB Protein has potential applications in various fields, including neuroscience, immunology, and regenerative medicine. One of the major applications of this protein is in the treatment of neurological disorders. Studies have shown that Recombinant Mouse RGMB Protein can promote axon regeneration and repair damaged neural tissue, making it a potential therapeutic agent for conditions such as spinal cord injury and stroke.

In the field of immunology, Recombinant Mouse RGMB Protein has been studied for its potential as an immunomodulatory agent. It has been shown to regulate the activity of immune cells, making it a potential treatment for autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis.

Furthermore, Recombinant Mouse RGMB Protein has also been studied for its potential in regenerative medicine. It has been shown to promote angiogenesis and tissue repair, making it a potential treatment for conditions such as diabetic ulcers and cardiovascular diseases.

Conclusion

Recombinant Mouse RGMB Protein is a biologically active protein with diverse functions in axon guidance, immune response, and tissue repair. Its structure, function, and potential applications make it a promising therapeutic target for various diseases. Further research and development of this protein could lead to the development of novel treatments for neurological disorders, inflammatory diseases, and tissue damage.

Recombinant Mouse RGMB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse RGMB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products