Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse WNT8A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q64527
Molecular weight:
26.60 kDa

Original price was: $282.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Thr31–Ala247
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse WNT8A Protein, N-His

Product name ARO-P10521-100
Uniprot ID Q64527
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TRPKAYLTYTASVALGAQIGIEECKFQFAWERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKNCSMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALVNLHNNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKRQLRAGNRAEGRWALTEAFLPSTEA
Molecular weight 26.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Ala247
Aliases /Synonyms WNT8D, Protein Wnt-8d, WNT8A, Protein Wnt-8a
Reference ARO-P10521
Note For research use only.
Molecular Constructor
Thr31–Ala247
Product name ARO-P10521-1MG
Uniprot ID Q64527
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TRPKAYLTYTASVALGAQIGIEECKFQFAWERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKNCSMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALVNLHNNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKRQLRAGNRAEGRWALTEAFLPSTEA
Molecular weight 26.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Ala247
Aliases /Synonyms WNT8D, Protein Wnt-8d, WNT8A, Protein Wnt-8a
Reference ARO-P10521
Note For research use only.
Molecular Constructor
Thr31–Ala247
Product name ARO-P10521-50
Uniprot ID Q64527
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TRPKAYLTYTASVALGAQIGIEECKFQFAWERWNCPEHAFQFSTHNRLRAATRETSFIHAIRSAAIMYAVTKNCSMGDLENCGCDESQNGKTGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGKDARALVNLHNNRAGRLAVRASTKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIEMDKRQLRAGNRAEGRWALTEAFLPSTEA
Molecular weight 26.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr31-Ala247
Aliases /Synonyms WNT8D, Protein Wnt-8d, WNT8A, Protein Wnt-8a
Reference ARO-P10521
Note For research use only.
Molecular Constructor
Thr31–Ala247

Introduction to Recombinant Mouse WNT8A Protein

Recombinant Mouse WNT8A Protein is a type of recombinant protein that plays a crucial role in the WNT signaling pathway. This protein is produced through recombinant DNA technology, where the gene encoding for WNT8A is inserted into a host cell, such as bacteria or yeast, to produce large quantities of the protein. This highly purified recombinant protein has been extensively studied and has shown promising results in various fields of research, including developmental biology, cancer biology, and regenerative medicine.

Structure of Recombinant Mouse WNT8A Protein

Recombinant Mouse WNT8A Protein is a member of the WNT family of secreted signaling proteins. It is a glycoprotein consisting of 350 amino acids with a molecular weight of approximately 40 kDa. The protein has a conserved cysteine-rich domain, which is essential for its biological activity. It also contains a signal peptide sequence that directs the protein to be secreted from the cell.

The crystal structure of Recombinant Mouse WNT8A Protein has been determined, revealing a unique three-dimensional structure with a central core of four alpha-helices surrounded by several loops and beta-sheets. This structure is crucial for the interaction of WNT8A with its receptors and other signaling molecules.

Activity of Recombinant Mouse WNT8A Protein

Recombinant Mouse WNT8A Protein is a potent activator of the WNT signaling pathway, which plays a critical role in embryonic development, tissue homeostasis, and stem cell maintenance. WNT8A binds to its receptors, Frizzled (FZD) and low-density lipoprotein receptor-related protein (LRP), on the cell surface, initiating a signaling cascade that leads to the activation of various downstream pathways, including the canonical and non-canonical pathways.

The canonical WNT signaling pathway is involved in cell proliferation, differentiation, and survival, while the non-canonical pathway regulates cell polarity, migration, and tissue morphogenesis. Recombinant Mouse WNT8A Protein has been shown to activate both pathways, depending on the context and cellular environment.

Application of Recombinant Mouse WNT8A Protein

Recombinant Mouse WNT8A Protein has a wide range of applications in various fields of research. In developmental biology, it has been extensively studied for its role in embryonic development, particularly in the formation of the central nervous system, limbs, and heart. Recombinant Mouse WNT8A Protein has also been shown to play a critical role in stem cell maintenance and differentiation, making it a valuable tool for regenerative medicine.

In cancer biology, Recombinant Mouse WNT8A Protein has been implicated in the development and progression of various types of cancer, including colon, breast, and lung cancer. It has been shown to promote tumor growth, invasion, and metastasis, making it a potential therapeutic target for cancer treatment.

Furthermore, Recombinant Mouse WNT8A Protein has been used in various in vitro and in vivo studies to investigate its role in tissue homeostasis, wound healing, and tissue regeneration. It has also been utilized in drug discovery and screening assays to identify potential inhibitors or activators of the WNT signaling pathway.

In conclusion, Recombinant Mouse WNT8A Protein is a highly purified and biologically active protein that has been extensively studied for its role in the WNT signaling pathway. Its unique structure and potent activity make it a valuable tool in various fields of research, including developmental biology, cancer biology, and regenerative medicine. With further research and development, this recombinant protein holds great potential for future therapeutic applications.

Recombinant Mouse WNT8A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse WNT8A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products