Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ZNRF3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q5SSZ7
Molecular weight:
19.27 kDa

Original price was: $301.00.Current price is: $274.00.

50ug 9% OFF + 274 loyalty points
Lys53–Pro207
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ZNRF3 Protein, N-His

Product name ARO-P10543-100
Uniprot ID Q5SSZ7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHLPP
Molecular weight 19.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Pro207
Aliases /Synonyms KIAA1133, RNF203, RING-type E3 ubiquitin transferase ZNRF3, ZNRF3, RING finger protein 203, Zinc/RING finger protein 3, E3 ubiquitin-protein ligase ZNRF3
Reference ARO-P10543
Note For research use only.
Molecular Constructor
Lys53–Pro207
Product name ARO-P10543-1MG
Uniprot ID Q5SSZ7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHLPP
Molecular weight 19.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Pro207
Aliases /Synonyms KIAA1133, RNF203, RING-type E3 ubiquitin transferase ZNRF3, ZNRF3, RING finger protein 203, Zinc/RING finger protein 3, E3 ubiquitin-protein ligase ZNRF3
Reference ARO-P10543
Note For research use only.
Molecular Constructor
Lys53–Pro207
Product name ARO-P10543-50
Uniprot ID Q5SSZ7
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHLPP
Molecular weight 19.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys53-Pro207
Aliases /Synonyms KIAA1133, RNF203, RING-type E3 ubiquitin transferase ZNRF3, ZNRF3, RING finger protein 203, Zinc/RING finger protein 3, E3 ubiquitin-protein ligase ZNRF3
Reference ARO-P10543
Note For research use only.
Molecular Constructor
Lys53–Pro207

Introduction

Recombinant Mouse ZNRF3 Protein is a highly versatile and important protein that plays a crucial role in various biological processes. It is a member of the ZNRF3 family of proteins, which are known for their ability to regulate the activity of Wnt signaling pathway. In this article, we will delve deeper into the structure, activity, and applications of Recombinant Mouse ZNRF3 Protein.

Structure of Recombinant Mouse ZNRF3 Protein

Recombinant Mouse ZNRF3 Protein is a 38 kDa protein that is composed of 349 amino acids. It consists of a transmembrane domain, a RING finger domain, and a C-terminal domain. The transmembrane domain is responsible for anchoring the protein to the cell membrane, while the RING finger domain is involved in the ubiquitination process. The C-terminal domain is responsible for the binding of the protein to Wnt receptors.

Activity of Recombinant Mouse ZNRF3 Protein

Recombinant Mouse ZNRF3 Protein is a potent inhibitor of the Wnt signaling pathway. It acts by promoting the ubiquitination and subsequent degradation of Wnt receptors, thus preventing the activation of the pathway. This activity is crucial for maintaining the balance of Wnt signaling, as dysregulation of this pathway has been linked to various diseases, including cancer.

In addition to its role in Wnt signaling, Recombinant Mouse ZNRF3 Protein has also been shown to play a role in regulating cell proliferation and differentiation. It has been found to inhibit the proliferation of cancer cells and promote the differentiation of stem cells into specific cell types.

Applications of Recombinant Mouse ZNRF3 Protein

Recombinant Mouse ZNRF3 Protein has a wide range of applications in both research and therapeutic settings. Its ability to regulate the Wnt signaling pathway makes it a valuable tool for studying the role of this pathway in various biological processes. It can be used to investigate the effects of Wnt signaling on cell proliferation, differentiation, and development.

In addition, Recombinant Mouse ZNRF3 Protein has potential therapeutic applications. Its ability to inhibit the Wnt signaling pathway makes it a potential target for cancer treatment. Studies have shown that overexpression of ZNRF3 can suppress the growth of various types of cancer cells, including colorectal, breast, and lung cancer.

Furthermore, Recombinant Mouse ZNRF3 Protein has been investigated as a potential treatment for bone-related disorders. It has been found to promote the differentiation of mesenchymal stem cells into osteoblasts, the cells responsible for bone formation. This suggests that it could be used to promote bone regeneration and repair in conditions such as osteoporosis and bone fractures.

Conclusion

In conclusion, Recombinant Mouse ZNRF3 Protein is a crucial player in the regulation of the Wnt signaling pathway. Its structure and activity make it a valuable tool for studying the role of this pathway in various biological processes. Moreover, its potential therapeutic applications make it a promising target for the treatment of cancer and bone-related disorders. Further research on this protein is necessary to fully understand its functions and potential uses in the future.

Recombinant Mouse ZNRF3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ZNRF3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products