Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant PDCoV NS6 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Porcine deltacoronavirus (PDCoV)
Uniprot ID:
ALA13748.1
Molecular weight:
38.90 kDa

Original price was: $307.00.Current price is: $271.00.

50ug 12% OFF + 271 loyalty points
GST Cys2–Asn94 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant PDCoV NS6 Protein, N-GST & C-His

Product name ARO-P16877-100
Uniprot ID ALA13748.1
Origin species Porcine deltacoronavirus (PDCoV)
Expression system Prokaryotic expression
Raw Antigen Sequence CNCHLQLRDLYRLCNKLHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
Molecular weight 38.90 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys2-Asn94
Aliases /Synonyms NS6 protein, NS6
Reference ARO-P16877
Note For research use only.
Molecular Constructor
GST Cys2–Asn94 His
Product name ARO-P16877-1MG
Uniprot ID ALA13748.1
Origin species Porcine deltacoronavirus (PDCoV)
Expression system Prokaryotic expression
Raw Antigen Sequence CNCHLQLRDLYRLCNKLHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
Molecular weight 38.90 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys2-Asn94
Aliases /Synonyms NS6 protein, NS6
Reference ARO-P16877
Note For research use only.
Molecular Constructor
GST Cys2–Asn94 His
Product name ARO-P16877-50
Uniprot ID ALA13748.1
Origin species Porcine deltacoronavirus (PDCoV)
Expression system Prokaryotic expression
Raw Antigen Sequence CNCHLQLRDLYRLCNKLHIRRDDVPELIDPLVKTRCFAYSLVVLANANPIAFSILPRKILINGEPLLLEYGSIYGKDFIIRPSLQVILEDELN
Molecular weight 38.90 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys2-Asn94
Aliases /Synonyms NS6 protein, NS6
Reference ARO-P16877
Note For research use only.
Molecular Constructor
GST Cys2–Asn94 His

SDS-PAGE for Recombinant PDCoV NS6 Protein, N-GST & C-His

SDS-PAGE for Recombinant PDCoV NS6 Protein, N-GST & C-His

Recombinant PDCoV NS6 Protein, N-GST & C-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant PDCoV NS6 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products