Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Peanut Ara h 2/Conglutin-7 Protein, N-Trx-His

Host species:
Escherichia coli (E.coli)
Origin species:
Arachis hypogaea (Peanut)
Uniprot ID:
Q6PSU2
Molecular weight:
35.18 kDa

Original price was: $337.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Ala21–Tyr172
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Peanut Ara h 2/Conglutin-7 Protein, N-Trx-His

Product name ARO-P11493-100
Uniprot ID Q6PSU2
Origin species Arachis hypogaea (Peanut)
Expression system Prokaryotic expression
Raw Antigen Sequence ARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
Molecular weight 35.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala21-Tyr172
Aliases /Synonyms Conglutin-7, 2S protein 1, Seed storage protein SSP1, Seed storage protein SSP2, Ara h 2, Arachis hypogaea (Peanut)
Reference ARO-P11493
Note For research use only.
Molecular Constructor
Ala21–Tyr172
Product name ARO-P11493-1MG
Uniprot ID Q6PSU2
Origin species Arachis hypogaea (Peanut)
Expression system Prokaryotic expression
Raw Antigen Sequence ARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
Molecular weight 35.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala21-Tyr172
Aliases /Synonyms Conglutin-7, 2S protein 1, Seed storage protein SSP1, Seed storage protein SSP2, Ara h 2, Arachis hypogaea (Peanut)
Reference ARO-P11493
Note For research use only.
Molecular Constructor
Ala21–Tyr172
Product name ARO-P11493-50
Uniprot ID Q6PSU2
Origin species Arachis hypogaea (Peanut)
Expression system Prokaryotic expression
Raw Antigen Sequence ARQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
Molecular weight 35.18 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala21-Tyr172
Aliases /Synonyms Conglutin-7, 2S protein 1, Seed storage protein SSP1, Seed storage protein SSP2, Ara h 2, Arachis hypogaea (Peanut)
Reference ARO-P11493
Note For research use only.
Molecular Constructor
Ala21–Tyr172

Introduction

Recombinant Peanut Ara h 2 or Conglutin-7 protein is a type of protein that is produced through genetic engineering techniques. This protein is derived from the peanut plant and is known to be a major allergen for individuals who are allergic to peanuts. In this article, we will discuss the structure, activity, and application of this recombinant protein.

Structure of Recombinant Peanut Ara h 2/Conglutin-7 Protein

The structure of Recombinant Peanut Ara h 2/Conglutin-7 protein is similar to that of the natural peanut protein. It is composed of 132 amino acids and has a molecular weight of approximately 15 kDa. The protein has a globular shape and is made up of four alpha-helices and six beta-strands, which are arranged in a compact fold.

Activity of Recombinant Peanut Ara h 2/Conglutin-7 Protein

Recombinant Peanut Ara h 2/Conglutin-7 protein is known to be a potent allergen, which means it can trigger an allergic reaction in individuals who are allergic to peanuts. The protein is able to bind to specific receptors on immune cells, known as IgE receptors, which then activate the immune response and cause the release of inflammatory mediators such as histamine.

Moreover, studies have shown that this recombinant protein has a high binding affinity to IgE antibodies from individuals with peanut allergies, indicating its strong allergenic activity. It has also been found to be resistant to digestion, making it more likely to trigger an allergic reaction in the digestive system.

Application of Recombinant Peanut Ara h 2/Conglutin-7 Protein

The main application of Recombinant Peanut Ara h 2/Conglutin-7 protein is in the field of allergy research. This protein is commonly used as a model allergen in studies to understand the mechanisms of peanut allergy and to develop potential treatments for peanut allergies.

One of the major applications of this recombinant protein is in the development of diagnostic tests for peanut allergies. These tests use the recombinant protein as an antigen to detect the presence of IgE antibodies in an individual’s blood, which can confirm a diagnosis of peanut allergy.

Furthermore, Recombinant Peanut Ara h 2/Conglutin-7 protein is also being studied for its potential use in immunotherapy, which involves exposing individuals to small amounts of the allergen to desensitize their immune system and reduce the severity of allergic reactions. This protein has been used in clinical trials to test the effectiveness of immunotherapy for peanut allergies.

In addition, this recombinant protein is also used in the production of hypoallergenic peanuts. By modifying the genetic sequence of the peanut plant to reduce the expression of the Ara h 2 protein, the resulting peanuts have a lower allergenic potential, making them safer for consumption by individuals with peanut allergies.

Conclusion

In summary, Recombinant Peanut Ara h 2/Conglutin-7 protein is a genetically engineered protein derived from the peanut plant. It has a similar structure to the natural peanut protein and is a potent allergen with a high binding affinity to IgE antibodies. The main application of this protein is in allergy research, particularly in the development of diagnostic tests and immunotherapy for peanut allergies. It is also being used in the production of hypoallergenic peanuts. Further research on this protein may lead to a better understanding of peanut allergies and potential treatments for this condition.

Recombinant Peanut Ara h 2/Conglutin-7 Protein, N-Trx-His

There are no reviews yet.

Be the first to review “Recombinant Peanut Ara h 2/Conglutin-7 Protein, N-Trx-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products