Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Protein A/SPA Protein, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Staphylococcus aureus
Uniprot ID:
P02976
Molecular weight:
33.88 kDa

Original price was: $326.00.Current price is: $274.00.

50ug 16% OFF + 274 loyalty points
Ala37–Lys327
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Protein A/SPA Protein, C-His

Product name ARO-P12733-100
Uniprot ID P02976
Origin species Staphylococcus aureus
Expression system Prokaryotic expression
Raw Antigen Sequence AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight 33.88 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala37-Lys327
Aliases /Synonyms Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A, SpA, spa, Bacteria,Protein A
Reference ARO-P12733
Note For research use only.
Molecular Constructor
Ala37–Lys327
Product name ARO-P12733-1MG
Uniprot ID P02976
Origin species Staphylococcus aureus
Expression system Prokaryotic expression
Raw Antigen Sequence AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight 33.88 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala37-Lys327
Aliases /Synonyms Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A, SpA, spa, Bacteria,Protein A
Reference ARO-P12733
Note For research use only.
Molecular Constructor
Ala37–Lys327
Product name ARO-P12733-50
Uniprot ID P02976
Origin species Staphylococcus aureus
Expression system Prokaryotic expression
Raw Antigen Sequence AQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight 33.88 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala37-Lys327
Aliases /Synonyms Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A, SpA, spa, Bacteria,Protein A
Reference ARO-P12733
Note For research use only.
Molecular Constructor
Ala37–Lys327

Introduction to Recombinant Protein A/SPA Protein

Recombinant Protein A/SPA Protein is a genetically engineered protein that has revolutionized the field of protein purification. It is derived from the cell wall of Staphylococcus aureus, a bacterium commonly found on human skin. The recombinant form of Protein A/SPA Protein is produced in large quantities in a laboratory setting, making it a readily available tool for researchers and scientists.

Structure of Recombinant Protein A/SPA Protein

The structure of Recombinant Protein A/SPA Protein is composed of five immunoglobulin-binding domains, also known as Ig-binding domains. These domains are responsible for the binding of the protein to the Fc region of immunoglobulins, specifically IgG. This binding is highly specific and strong, making Recombinant Protein A/SPA Protein an ideal tool for purifying antibodies.

In addition to the Ig-binding domains, Recombinant Protein A/SPA Protein also contains a cell wall binding domain, which allows it to bind to the cell wall of Staphylococcus aureus. This property is important for the purification process, as it allows for easy separation of the protein from the bacterial cells.

Activity of Recombinant Protein A/SPA Protein

The main activity of Recombinant Protein A/SPA Protein is its ability to bind to immunoglobulins, specifically IgG. This binding occurs through the Fc region of the immunoglobulin, which is responsible for the effector functions of antibodies. The binding of Recombinant Protein A/SPA Protein to the Fc region does not interfere with the antigen-binding site, allowing for the purification of intact and functional antibodies.

Another important activity of Recombinant Protein A/SPA Protein is its ability to bind to the cell wall of Staphylococcus aureus. This binding is mediated by the cell wall binding domain of the protein and is crucial for the purification process. The binding of Recombinant Protein A/SPA Protein to the cell wall allows for easy separation of the protein from the bacterial cells, resulting in a highly pure and concentrated product.

Applications of Recombinant Protein A/SPA Protein

Recombinant Protein A/SPA Protein has a wide range of applications in the field of protein purification. Its main use is in the purification of antibodies, as it allows for the isolation of high-quality, functional antibodies from complex biological samples. This has numerous applications in research, diagnostics, and therapeutics.

In addition, Recombinant Protein A/SPA Protein can also be used for the purification of other proteins that contain an Fc region, such as fusion proteins or recombinant proteins produced in mammalian cells. This allows for the removal of unwanted contaminants and the isolation of highly pure and functional proteins.

Furthermore, Recombinant Protein A/SPA Protein can also be used in affinity chromatography for the purification of proteins that have been engineered to contain an Ig-binding domain. This technique is often used in the production of biopharmaceuticals, as it allows for the purification of specific proteins from complex mixtures.

Conclusion

In summary, Recombinant Protein A/SPA Protein is a highly versatile and valuable tool in the field of protein purification. Its unique structure and specific activities make it an essential component in the isolation of high-quality antibodies and other proteins. Its applications in research, diagnostics, and therapeutics continue to expand, making it an indispensable tool for scientists and researchers worldwide.

Recombinant Protein A/SPA Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Protein A/SPA Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products