Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Rat SOCS3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Rat
Uniprot ID:
O88583
Molecular weight:
27 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Met1–Leu225
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Rat SOCS3 Protein, N-His

Product name ARO-P10874-100
Uniprot ID O88583
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Molecular weight 27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu225
Aliases /Synonyms Cytokine-inducible SH2 protein 3, CIS-3, SSI-3, Suppressor of cytokine signaling 3, CIS3, STAT-induced STAT inhibitor 3, SSI3, SOCS3, SOCS-3,
Reference ARO-P10874
Note For research use only.
Molecular Constructor
Met1–Leu225
Product name ARO-P10874-1MG
Uniprot ID O88583
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Molecular weight 27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu225
Aliases /Synonyms Cytokine-inducible SH2 protein 3, CIS-3, SSI-3, Suppressor of cytokine signaling 3, CIS3, STAT-induced STAT inhibitor 3, SSI3, SOCS3, SOCS-3,
Reference ARO-P10874
Note For research use only.
Molecular Constructor
Met1–Leu225
Product name ARO-P10874-50
Uniprot ID O88583
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Molecular weight 27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu225
Aliases /Synonyms Cytokine-inducible SH2 protein 3, CIS-3, SSI-3, Suppressor of cytokine signaling 3, CIS3, STAT-induced STAT inhibitor 3, SSI3, SOCS3, SOCS-3,
Reference ARO-P10874
Note For research use only.
Molecular Constructor
Met1–Leu225

Recombinant Rat SOCS3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Rat SOCS3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products