Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

RHD recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q02161
Molecular weight:
36.51 kDa

Original price was: $303.00.Current price is: $274.00.

50ug 10% OFF + 274 loyalty points
Ser2–Gly87 N-GST
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

RHD recombinant protein

Product name PX-P5200-100
Uniprot ID Q02161
Uniprot link https://www.uniprot.org/uniprot/Q02161
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG
Molecular weight 36.51 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly87
Protein Accession Q02161
Aliases /Synonyms CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen
Reference PX-P5200
Note For research use only
Molecular Constructor
Ser2–Gly87 N-GST
Product name PX-P5200-1MG
Uniprot ID Q02161
Uniprot link https://www.uniprot.org/uniprot/Q02161
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG
Molecular weight 36.51 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly87
Protein Accession Q02161
Aliases /Synonyms CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen
Reference PX-P5200
Note For research use only
Molecular Constructor
Ser2–Gly87 N-GST
Product name PX-P5200-50
Uniprot ID Q02161
Uniprot link https://www.uniprot.org/uniprot/Q02161
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALG
Molecular weight 36.51 kDa
Protein delivered with Tag? N-GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Gly87
Protein Accession Q02161
Aliases /Synonyms CD240D, RHXIII, Blood group Rh(D) polypeptide, Rh polypeptide 2, RhPII, Rhesus D antigen
Reference PX-P5200
Note For research use only
Molecular Constructor
Ser2–Gly87 N-GST

RHD recombinant protein

There are no reviews yet.

Be the first to review “RHD recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products