Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

RRV Spike glycoprotein E2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Ross river virus (RRV)
Uniprot ID:
QFR08198.1

Original price was: $314.00.Current price is: $271.00.

50ug 14% OFF + 271 loyalty points
His Ser335–Gly694
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

RRV Spike glycoprotein E2, N-His

Product name ARO-P18771-100
Uniprot ID QFR08198.1
Origin species Ross river virus (RRV)
Expression system Prokaryotic expression
Raw Antigen Sequence SVTEHFNVYKATRPYLAHCADCGDGYFCYSPVAIEKIRDEASDGMLKIQVSAQIGLDKAGTHAHTKMRYMAGHDVQESKRDSLRVYTSAACSIRGTMGHFIVAHCPPGDYLKVSFEDADSHVKACKVQYKHDPLPVGREKFVVRPHFGVELPCTSYQLTTAPTDEEIDMHTPPDIPDRTLLSQTAGNVKITAGGRTIRYNCTCGRDNVGTTSTDKTINTCKIDQCHAAVTSHDKWQFTSPFVPRADQTARKGKVHVPFPLTNVTCRVPLARAPDVTYGKKEVTLRLHPDHPTLFSYRSLGAVPHPYEEWVDKFSERIIPVTEEGIEYQWGNNPPVRLWAQLTTEGKPHGWPHEIIQYYYG
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser335-Gly694
Aliases /Synonyms Structural polyprotein, p130, Capsid protein, 3.4.21.90, Coat protein, C, Precursor of protein E3/E2, p62, pE2, Assembly protein E3, Spike glycoprotein E2, E2 envelope glycoprotein, 6K protein, Spike glycoprotein E1, E1 envelope glycoprotein
Reference ARO-P18771
Note For research use only.
Molecular Constructor
His Ser335–Gly694
Product name ARO-P18771-1MG
Uniprot ID QFR08198.1
Origin species Ross river virus (RRV)
Expression system Prokaryotic expression
Raw Antigen Sequence SVTEHFNVYKATRPYLAHCADCGDGYFCYSPVAIEKIRDEASDGMLKIQVSAQIGLDKAGTHAHTKMRYMAGHDVQESKRDSLRVYTSAACSIRGTMGHFIVAHCPPGDYLKVSFEDADSHVKACKVQYKHDPLPVGREKFVVRPHFGVELPCTSYQLTTAPTDEEIDMHTPPDIPDRTLLSQTAGNVKITAGGRTIRYNCTCGRDNVGTTSTDKTINTCKIDQCHAAVTSHDKWQFTSPFVPRADQTARKGKVHVPFPLTNVTCRVPLARAPDVTYGKKEVTLRLHPDHPTLFSYRSLGAVPHPYEEWVDKFSERIIPVTEEGIEYQWGNNPPVRLWAQLTTEGKPHGWPHEIIQYYYG
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser335-Gly694
Aliases /Synonyms Structural polyprotein, p130, Capsid protein, 3.4.21.90, Coat protein, C, Precursor of protein E3/E2, p62, pE2, Assembly protein E3, Spike glycoprotein E2, E2 envelope glycoprotein, 6K protein, Spike glycoprotein E1, E1 envelope glycoprotein
Reference ARO-P18771
Note For research use only.
Molecular Constructor
His Ser335–Gly694
Product name ARO-P18771-50
Uniprot ID QFR08198.1
Origin species Ross river virus (RRV)
Expression system Prokaryotic expression
Raw Antigen Sequence SVTEHFNVYKATRPYLAHCADCGDGYFCYSPVAIEKIRDEASDGMLKIQVSAQIGLDKAGTHAHTKMRYMAGHDVQESKRDSLRVYTSAACSIRGTMGHFIVAHCPPGDYLKVSFEDADSHVKACKVQYKHDPLPVGREKFVVRPHFGVELPCTSYQLTTAPTDEEIDMHTPPDIPDRTLLSQTAGNVKITAGGRTIRYNCTCGRDNVGTTSTDKTINTCKIDQCHAAVTSHDKWQFTSPFVPRADQTARKGKVHVPFPLTNVTCRVPLARAPDVTYGKKEVTLRLHPDHPTLFSYRSLGAVPHPYEEWVDKFSERIIPVTEEGIEYQWGNNPPVRLWAQLTTEGKPHGWPHEIIQYYYG
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser335-Gly694
Aliases /Synonyms Structural polyprotein, p130, Capsid protein, 3.4.21.90, Coat protein, C, Precursor of protein E3/E2, p62, pE2, Assembly protein E3, Spike glycoprotein E2, E2 envelope glycoprotein, 6K protein, Spike glycoprotein E1, E1 envelope glycoprotein
Reference ARO-P18771
Note For research use only.
Molecular Constructor
His Ser335–Gly694

There are no reviews yet.

Be the first to review “RRV Spike glycoprotein E2, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products