Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Seniprutug Biosimilar – Anti-TRBV9 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Seniprutug Biosimilar - Anti-TRBV9 mAb - Research Grade

Product name PX-TA2138-50
Uniprot ID A0A0B4J1U6
Source CAS: 2484772-72-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIHYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSV
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2138
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Seniprutug Biosimilar - Anti-TRBV9 mAb - Research Grade
Uniprot ID A0A0B4J1U6
Source CAS: 2484772-72-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIHYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSV
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2138
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Seniprutug Biosimilar - Anti-TRBV9 mAb - Research Grade
Uniprot ID A0A0B4J1U6
Source CAS: 2484772-72-5
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLITATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQFLIHYYNGEERAKGNILERFSAQQFPDLHSELNLSSLELGDSALYFCASSV
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2138
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Seniprutug Biosimilar – Anti-TRBV9 mAb – Research Grade is a novel biosimilar antibody that targets the TRBV9 protein. This antibody is designed to mimic the structure and function of the original Seniprutug antibody, while offering a more affordable and accessible option for researchers and scientists. In this article, we will explore the structure, activity, and potential applications of this biosimilar antibody.

The Seniprutug Biosimilar – Anti-TRBV9 mAb is a monoclonal antibody, meaning it is produced from a single clone of B cells. It is composed of two identical heavy chains and two identical light chains, linked together by disulfide bonds. The heavy chains consist of a constant region and a variable region, while the light chains only have a variable region. The variable regions of both chains are responsible for binding to the TRBV9 protein.

The structure of this biosimilar antibody is carefully engineered to closely resemble the original Seniprutug antibody. This ensures that it retains the same specificity and affinity for the TRBV9 protein, while also minimizing any potential immunogenicity.

The main activity of Seniprutug Biosimilar – Anti-TRBV9 mAb is its ability to bind to the TRBV9 protein. This protein is a member of the T cell receptor (TCR) family, which is involved in recognizing and responding to foreign antigens. By binding to TRBV9, this biosimilar antibody can block its interaction with other proteins and potentially inhibit T cell activation.

In addition to its binding activity, the Seniprutug Biosimilar – Anti-TRBV9 mAb also has effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These functions can enhance the antibody’s ability to eliminate cells expressing the TRBV9 protein, making it a potential therapeutic option for certain diseases.

The primary application of Seniprutug Biosimilar – Anti-TRBV9 mAb is in research and development. Its high specificity and affinity for the TRBV9 protein make it a valuable tool for studying the function and role of this protein in various diseases. It can also be used to screen for potential therapeutic agents that target TRBV9.

Furthermore, the Seniprutug Biosimilar – Anti-TRBV9 mAb has potential therapeutic applications in diseases where TRBV9 is implicated. This includes certain autoimmune disorders, such as rheumatoid arthritis and multiple sclerosis, as well as certain types of cancer. By targeting and blocking TRBV9, this biosimilar antibody may be able to modulate the immune response and potentially improve disease outcomes.

In summary, Seniprutug Biosimilar – Anti-TRBV9 mAb – Research Grade is a promising biosimilar antibody that targets the TRBV9 protein. Its carefully engineered structure and high activity make it a valuable tool for research and potential therapeutic applications. As more studies are conducted, we may see the full potential of this biosimilar antibody in the field of immunology and beyond.

SDS-PAGE for Research Grade Seniprutug

SDS-PAGE for Research Grade Seniprutug

Research Grade Seniprutug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Seniprutug Biosimilar - Anti-TRBV9 mAb - Research Grade

There are no reviews yet.

Be the first to review “Seniprutug Biosimilar – Anti-TRBV9 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products