Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Serum paraoxonase-lactonase 3(PON3)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q15166
Molecular weight:
37.51 kDa

$392.00

100ug + 392 loyalty points
His Leu22–Leu354
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Serum paraoxonase-lactonase 3(PON3)

Serum paraoxonase-lactonase 3(PON3)

Product name Serum paraoxonase-lactonase 3(PON3)
Uniprot ID Q15166
Uniprot link https://www.uniprot.org/uniprot/Q15166
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence LAFRERVNASREVEPVEPENCHLIEELENGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQ NPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKS VNDIVVLGPEQFYATRDHYFTNSLLSFFEMILDLRWTYVLFYSPREVKVVAKGFCSANGITVSADQKYVYVA DVAAKNIHIMEKHDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPGSEVLRIQNV LSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTLYCEL*
Molecular weight 37.51 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu22-Leu354
Protein Accession Q15166
Spec:Entrez GeneID 5446
Spec:SwissProtID Q9BZH9
NCBI Reference Q15166
Aliases /Synonyms /
Reference PX-P4784
Note For research use only
Molecular Constructor
His Leu22–Leu354
Product name Serum paraoxonase-lactonase 3(PON3)
Uniprot ID Q15166
Uniprot link https://www.uniprot.org/uniprot/Q15166
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence LAFRERVNASREVEPVEPENCHLIEELENGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQ NPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTVEIFKFEEQQRSLVYLKTIKHELLKS VNDIVVLGPEQFYATRDHYFTNSLLSFFEMILDLRWTYVLFYSPREVKVVAKGFCSANGITVSADQKYVYVA DVAAKNIHIMEKHDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPGSEVLRIQNV LSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTLYCEL*
Molecular weight 37.51 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu22-Leu354
Protein Accession Q15166
Spec:Entrez GeneID 5446
Spec:SwissProtID Q9BZH9
NCBI Reference Q15166
Aliases /Synonyms /
Reference PX-P4784
Note For research use only
Molecular Constructor
His Leu22–Leu354

There are no reviews yet.

Be the first to review “Serum paraoxonase-lactonase 3(PON3)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products