Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Sirexatamab Biosimilar – Anti-Dickkopf-1 mAb – Research Grade

  • PX-TA1779-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $208.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

Product name Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade
Uniprot ID O94907
Source CAS: 2414962-49-3
Species Humanized
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Sirexatamab,DKN-01, LY-2812176,Dickkopf-1,anti-Dickkopf-1
Reference PX-TA1779
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade
Uniprot ID O94907
Source CAS: 2414962-49-3
Species Humanized
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Sirexatamab,DKN-01, LY-2812176,Dickkopf-1,anti-Dickkopf-1
Reference PX-TA1779
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1779-50
Uniprot ID O94907
Source CAS: 2414962-49-3
Species Humanized
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Sirexatamab,DKN-01, LY-2812176,Dickkopf-1,anti-Dickkopf-1
Reference PX-TA1779
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Sirexatamab Biosimilar, also known as Anti-Dickkopf-1 mAb, is a novel antibody that has shown promising results in pre-clinical and clinical studies. This biosimilar is designed to target a specific protein called Dickkopf-1 (DKK1), which has been found to play a crucial role in the development and progression of various diseases. In this article, we will discuss the structure, activity, and potential applications of Sirexatamab Biosimilar as a therapeutic agent.

Structure of Sirexatamab Biosimilar

Sirexatamab Biosimilar is a monoclonal antibody, meaning it is produced from a single clone of immune cells. It is a fully humanized antibody, which means that it is derived from human cells and has a structure similar to natural human antibodies. The antibody consists of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains contain a constant region and a variable region, while the light chains only have a variable region. The variable regions are responsible for binding to the target protein, DKK1.

Activity of Sirexatamab Biosimilar

The main activity of Sirexatamab Biosimilar is to bind to DKK1 and inhibit its function. DKK1 is a secreted protein that acts as an antagonist of the Wnt signaling pathway. This pathway plays a crucial role in cell growth, differentiation, and survival. By binding to DKK1, Sirexatamab Biosimilar prevents it from interacting with its receptors and inhibits the Wnt signaling pathway. This, in turn, leads to a decrease in cell proliferation and survival, making it a potential therapeutic target for various diseases.

Applications of Sirexatamab Biosimilar

Sirexatamab Biosimilar has shown promising results in pre-clinical studies as a potential treatment for multiple myeloma, a type of blood cancer. In a phase I clinical trial, it was found to be well-tolerated and showed promising efficacy in patients with relapsed or refractory multiple myeloma. The biosimilar is also being investigated as a potential treatment for other types of cancer, such as solid tumors and hematologic malignancies.

In addition to its potential as a cancer treatment, Sirexatamab Biosimilar has also shown promise in the treatment of other diseases. DKK1 has been found to play a role in bone metabolism, and its inhibition has been linked to an increase in bone formation. This makes Sirexatamab Biosimilar a potential treatment for bone-related diseases, such as osteoporosis and bone metastases.

Furthermore, DKK1 has been implicated in autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus. By inhibiting DKK1, Sirexatamab Biosimilar may have potential as a treatment for these conditions as well.

Conclusion

In summary, Sirexatamab Biosimilar, also known as Anti-Dickkopf-1 mAb, is a novel monoclonal antibody with a unique structure and mechanism of action. It binds to DKK1 and inhibits its function, making it a potential therapeutic target for various diseases. Its promising results in pre-clinical and clinical studies make it a promising candidate for the treatment of cancer, bone-related diseases, and autoimmune disorders. Further research and clinical trials are needed to fully explore the potential of this biosimilar as a therapeutic agent.

SEC-HPLC of Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

SEC-HPLC of Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

SDS-PAGE for Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Sirexatamab Biosimilar - Anti-Dickkopf-1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Sirexatamab Biosimilar – Anti-Dickkopf-1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products