Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Stanniocalcin 1

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P52823
Molecular weight:
49.49 kDa

Original price was: $274.00.Current price is: $230.00.

50ug 16% OFF + 230 loyalty points
Ser28–Ala247 GST
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Stanniocalcin 1

Stanniocalcin 1

Product name PX-P4987-100
Uniprot ID P52823
Uniprot link https://www.uniprot.org/uniprot/P52823
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Molecular weight 49.49 kDa
Protein delivered with Tag? GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser28-Ala247
Protein Accession P52823
Aliases /Synonyms STC1
Reference PX-P4987
Note For research use only
Molecular Constructor
Ser28–Ala247 GST
Product name PX-P4987-1MG
Uniprot ID P52823
Uniprot link https://www.uniprot.org/uniprot/P52823
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Molecular weight 49.49 kDa
Protein delivered with Tag? GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser28-Ala247
Protein Accession P52823
Aliases /Synonyms STC1
Reference PX-P4987
Note For research use only
Molecular Constructor
Ser28–Ala247 GST
Product name PX-P4987-50
Uniprot ID P52823
Uniprot link https://www.uniprot.org/uniprot/P52823
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence SPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Molecular weight 49.49 kDa
Protein delivered with Tag? GST Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser28-Ala247
Protein Accession P52823
Aliases /Synonyms STC1
Reference PX-P4987
Note For research use only
Molecular Constructor
Ser28–Ala247 GST

Stanniocalcin 1

There are no reviews yet.

Be the first to review “Stanniocalcin 1”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products