Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Suvemcitug Biosimilar – Anti-Vascular endothelial growth factor A mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $208.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Suvemcitug Biosimilar - Anti-Vascular endothelial growth factor A mAb - Research Grade

Product name Suvemcitug Biosimilar - Anti-Vascular endothelial growth factor A mAb - Research Grade
Uniprot ID P15692
Source CAS: 1610010-57-5
Species Human
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Vascular endothelial growth factor A, VPF, VEGFA, VEGF, Vascular permeability factor, VEGF-A
Reference PX-TA1939
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Suvemcitug Biosimilar - Anti-Vascular endothelial growth factor A mAb - Research Grade
Uniprot ID P15692
Source CAS: 1610010-57-5
Species Human
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Vascular endothelial growth factor A, VPF, VEGFA, VEGF, Vascular permeability factor, VEGF-A
Reference PX-TA1939
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1939-50
Uniprot ID P15692
Source CAS: 1610010-57-5
Species Human
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Vascular endothelial growth factor A, VPF, VEGFA, VEGF, Vascular permeability factor, VEGF-A
Reference PX-TA1939
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Suvemcitug Biosimilar – Anti-Vascular Endothelial Growth Factor A mAb Suvemcitug Biosimilar is a type of monoclonal antibody (mAb) that specifically targets and inhibits the activity of vascular endothelial growth factor A (VEGF-A). It is a research grade antibody that has shown promising results in various pre-clinical studies and is currently being developed as a potential therapeutic option for various diseases.

Structure of Suvemcitug Biosimilar

Suvemcitug Biosimilar is a fully humanized mAb, meaning that it is derived from human cells and has a high affinity for its target, VEGF-A. It is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The variable regions of the antibody, responsible for binding to VEGF-A, are located at the tips of the heavy and light chains. These regions have undergone extensive engineering to ensure a high specificity and affinity for VEGF-A.

Activity of Suvemcitug Biosimilar

VEGF-A is a key signaling protein involved in the formation of new blood vessels, a process known as angiogenesis. In certain diseases, such as cancer and age-related macular degeneration, VEGF-A is overexpressed, leading to excessive angiogenesis and disease progression. Suvemcitug Biosimilar works by binding to VEGF-A and preventing it from interacting with its receptors on the surface of blood vessel cells. This effectively blocks the signaling pathway and inhibits angiogenesis, thereby slowing down disease progression.

Application of Suvemcitug Biosimilar

As a research grade antibody, Suvemcitug Biosimilar is primarily used in laboratory settings to study the role of VEGF-A in various diseases. It is also being evaluated as a potential therapeutic option for diseases where VEGF-A is implicated, such as cancer and age-related macular degeneration. In pre-clinical studies, Suvemcitug Biosimilar has shown promising results in inhibiting tumor growth and reducing the formation of new blood vessels in animal models of cancer. It has also been shown to improve vision in animal models of age-related macular degeneration.

Therapeutic Potential of Suvemcitug Biosimilar

The potential therapeutic applications of Suvemcitug Biosimilar are vast, given the role of VEGF-A in various diseases. In cancer, it could be used as a monotherapy or in combination with other treatments to inhibit tumor growth and metastasis. In age-related macular degeneration, Suvemcitug Biosimilar could potentially slow down disease progression and improve vision. It could also have potential applications in other diseases where angiogenesis plays a role, such as diabetic retinopathy and rheumatoid arthritis.

Conclusion

In summary, Suvemcitug Biosimilar is a research grade monoclonal antibody that specifically targets and inhibits the activity of VEGF-A. Its structure and activity make it a promising therapeutic option for diseases where VEGF-A is implicated. Further studies and clinical trials are needed to fully understand its potential and determine its efficacy and safety in treating various diseases.

SDS-PAGE for Research Grade Suvemcitug

SDS-PAGE for Research Grade Suvemcitug

Research Grade Suvemcitug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Suvemcitug Biosimilar - Anti-Vascular endothelial growth factor A mAb - Research Grade

There are no reviews yet.

Be the first to review “Suvemcitug Biosimilar – Anti-Vascular endothelial growth factor A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products