Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vilastobart Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA2149-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1-fused prodomain kappa

Original price was: $233.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Vilastobart Biosimilar - Anti-CD152 mAb - Research Grade

Product name PX-TA2149-50
Uniprot ID P16410
Source CAS: 2760549-50-4
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2149
Note For research use only. Not suitable for human use.
Isotype IgG1-fused prodomain kappa
Clonality Monoclonal Antibody
Product name Vilastobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2760549-50-4
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2149
Note For research use only. Not suitable for human use.
Isotype IgG1-fused prodomain kappa
Clonality Monoclonal Antibody
Product name Vilastobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2760549-50-4
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2149
Note For research use only. Not suitable for human use.
Isotype IgG1-fused prodomain kappa
Clonality Monoclonal Antibody

Introduction

Vilastobart Biosimilar is a research grade antibody that targets the protein CD152. This antibody is a biosimilar of the therapeutic antibody Vilastobart, which is used in the treatment of various diseases. In this article, we will discuss the structure, activity, and applications of Vilastobart Biosimilar in detail.

Structure of Vilastobart Biosimilar

Vilastobart Biosimilar is a monoclonal antibody that is produced in a laboratory using recombinant DNA technology. It is a type of immunoglobulin G (IgG) antibody that is composed of two heavy chains and two light chains. The heavy chains are made up of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains have two constant regions (CL) and one variable region (VL). The variable regions of both the heavy and light chains are responsible for the specificity of the antibody towards its target, CD152.

Activity of Vilastobart Biosimilar

Vilastobart Biosimilar specifically binds to CD152, a protein that is found on the surface of immune cells called T cells. CD152 is also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) and is a key regulator of T cell activity. By binding to CD152, Vilastobart Biosimilar blocks its function and prevents the activation of T cells. This leads to a decrease in the immune response, which can be beneficial in certain diseases.

In addition to its inhibitory activity on T cells, Vilastobart Biosimilar also has an indirect effect on other immune cells. This is because T cells play a crucial role in regulating the activity of other immune cells, such as B cells and natural killer (NK) cells. By inhibiting T cell activity, Vilastobart Biosimilar indirectly affects the function of these cells as well.

Applications of Vilastobart Biosimilar

Vilastobart Biosimilar has various applications in both research and clinical settings. In research, it is commonly used to study the role of CD152 in immune responses and to investigate potential therapeutic targets for diseases that involve dysregulated immune responses.

In clinical settings, Vilastobart Biosimilar is used as a research grade antibody for the development of new therapeutic treatments. It can also be used as a biosimilar to Vilastobart in the treatment of diseases such as rheumatoid arthritis, psoriasis, and certain types of cancer. By inhibiting T cell activity, Vilastobart Biosimilar can help reduce inflammation and control the immune response in these diseases.

Conclusion

In summary, Vilastobart Biosimilar is a research grade antibody that specifically targets CD152, a protein involved in regulating T cell activity. It has various applications in research and clinical settings and can be used as a biosimilar to Vilastobart in the treatment of certain diseases. Its structure, activity, and applications make it a valuable tool in the study and treatment of immune-related disorders.

Research Grade Vilastobart binds to Mouse CD152 recombinant protein in WB Assay

Research Grade Vilastobart binds to Mouse CD152 recombinant protein in WB Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) can bind Research Grade Vilastobart in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Research Grade Vilastobart

SDS-PAGE for Research Grade Vilastobart

Research Grade Vilastobart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Vilastobart Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Vilastobart Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products