Drosophila RBf1 Recombinant Protein

Reference:
Size

100ug, 50ug

Brand

Product type

Host Species

Applications

,

Product nameDrosophila RBf1 Recombinant Protein
Uniprot IDQ24472
Uniprot linkhttp://www.uniprot.org/uniprot/Q24472
Origin speciesDrosophila
Expression systemProkaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSTELDFRHNP HCILSNFCDMTEEAKAMKATTFRQIMSSFFQASTIYGNKDTMLGLLANENFERNLKSLNISYEQYVLSVGEFDERILSAY DAGEHTALNDQSLRPPVTPLTRKQDLPAQPAMAGDKFEPVRNATNNVKQLSAFGRITEPTDFVKQAGEEVIAKLLSIIEE IEQKFLAKYPSTEAKSRFQLAKSFFFYLLDQILQAEIRNKPDIDLKRLLVQKVSLVIFNITLMACCVELVLEAYKTELKF PWVLDCFSISAFEFQKIIEIVVRHGSHEGCLNRSLIKHLNSIEETCLERLAWARNSTVWEMIASAQLPLPTWLMVNLDRA AGPLQIFLRKVYLLGWLRIQKLCSELSLCEKTPESIWHIFEHSITHETELMKDRHLDQNIMCAIYIYIRVKRMEDPKFSD IMRAYRNQPQAVNSVYREVFIDINEDGEPKVKDIIHFYNHTYVPLMRQFVIDYLNVTPDVSGRASDLQLSPHPKERAAQP KKVTQSHSLFVSQMSKNEIQQSPNQMVYSFCRSPAKDLQAMNEKVRGGKRMLSFGDEPGLGTMAETKRSKISQVKAVMDD PELQSAEQQTAVTTEGCVGGEGGEHET
Molecular weight94,87 kDa
Purity estimated80%
BufferTrisHC 50mMl, 10mM glutathione reduced pH8
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypePartial
Protein AccessionNP_525036.2
Spec:Entrez GeneID31027
Spec:NCBI Gene AliasesRBF1, Rbf1, rb, pRb, rbf, dRBF, RB, Rb1, DmelCG7413, EG:34F3.3, Rb, RBF, RbF, rbf1, CG7413, FBF
Spec:SwissProtIDQ24472
NCBI ReferenceNP_525036.2
Aliases /SynonymsRBf1, Retinoblastoma-family protein, CG7413, rb, pRb, rbf, dRBF, RB, Rb1, DmelCG7413, EG:34F3.3, Rb, RBF, RbF, rbf1, CG7413, FBF
ReferencePX-P1145
NoteFor research use only

Description of Drosophila RBf1 Recombinant Protein

General information on Drosophila RBf1 Recombinant Protein

The retinoblastoma protein (pRb) is a tumor suppressor protein that is dysfunctional in a lot of cancers. Retinoblastoma family protein (Rbf) from Drosophila melanogaster (Fruit fly) plays an important role in cell cycle regulation. It is also a component of the DREAM complex, a multi-protein complex that can act as a transcription activator or repressor. In follicle cells, the complex may have a main role in the site-specific DNA replication at the chorion loci. During development, the complex represses transcription of developmentally controlled E2F target genes.

Publication

  • 1: Nicolay BN, Gameiro PA, Tschöp K, Korenjak M, Heilmann AM, Asara JM, Stephanopoulos G, Iliopoulos O, Dyson NJ. Loss of RBF1 changes glutamine catabolism. Genes Dev. 2013 Jan 15;27(2):182-96. doi: 10.1101/gad.206227.112. Epub 2013 Jan 15. PubMed PMID: 23322302; PubMed Central PMCID: PMC3566311.
  • 2: Raj N, Zhang L, Wei Y, Arnosti DN, Henry RW. Ubiquitination of retinoblastoma family protein 1 potentiates gene-specific repression function. J Biol Chem. 2012 Dec 7;287(50):41835-43. doi: 10.1074/jbc.M112.422428. Epub 2012 Oct 18. PubMed PMID: 23086928; PubMed Central PMCID: PMC3516731.
  • 3: Keller SA, Ullah Z, Buckley MS, Henry RW, Arnosti DN. Distinct developmental expression of Drosophila retinoblastoma factors. Gene Expr Patterns. 2005 Feb;5(3):411-21. PubMed PMID: 15661648.
  • 4: Clavier A, Rincheval-Arnold A, Baillet A, Mignotte B, Guénal I. Two different specific JNK activators are required to trigger apoptosis or compensatory proliferation in response to Rbf1 in Drosophila. Cell Cycle. 2016;15(2):283-94. doi: 10.1080/15384101.2015.1100776. PubMed PMID: 26825229; PubMed Central PMCID: PMC4825841.
  • 5: Ran X, Bian X, Ji Y, Yan X, Yang F, Li F. White spot syndrome virus IE1 and WSV056 modulate the G1/S transition by binding to the host retinoblastoma protein. J Virol. 2013 Dec;87(23):12576-82. doi: 10.1128/JVI.01551-13. Epub 2013 Sep 11. PubMed PMID: 24027329; PubMed Central PMCID: PMC3838160.
  • 6: Edgar KA, Belvin M, Parks AL, Whittaker K, Mahoney MB, Nicoll M, Park CC, Winter CG, Chen F, Lickteig K, Ahmad F, Esengil H, Lorenzi MV, Norton A, Rupnow BA, Shayesteh L, Tabios M, Young LM, Carroll PM, Kopczynski C, Plowman GD, Friedman LS, Francis-Lang HL. Synthetic lethality of retinoblastoma mutant cells in the Drosophila eye by mutation of a novel peptidyl prolyl isomerase gene. Genetics. 2005 May;170(1):161-71. Epub 2005 Mar 2. PubMed PMID: 15744054; PubMed Central PMCID: PMC1449713.
  • 7: Milet C, Rincheval-Arnold A, Moriéras A, Clavier A, Garrigue A, Mignotte B, Guénal I. Mutating RBF can enhance its pro-apoptotic activity and uncovers a new role in tissue homeostasis. PLoS One. 2014 Aug 4;9(8):e102902. doi: 10.1371/journal.pone.0102902. eCollection 2014. PubMed PMID: 25089524; PubMed Central PMCID: PMC4121136.
  • 8: Krivy K, Bradley-Gill MR, Moon NS. Capicua regulates proliferation and survival of RB-deficient cells in Drosophila. Biol Open. 2013 Feb 15;2(2):183-90. doi: 10.1242/bio.20123277. Epub 2012 Nov 23. PubMed PMID: 23429853; PubMed Central PMCID: PMC3575652.
  • 9: Raj N, Zhang L, Wei Y, Arnosti DN, Henry RW. Rbf1 degron dysfunction enhances cellular DNA replication. Cell Cycle. 2012 Oct 15;11(20):3731-8. doi: 10.4161/cc.21665. Epub 2012 Aug 16. PubMed PMID: 22895052; PubMed Central PMCID: PMC3495815.
  • 10: Manning AL, Longworth MS, Dyson NJ. Loss of pRB causes centromere dysfunction and chromosomal instability. Genes Dev. 2010 Jul 1;24(13):1364-76. doi: 10.1101/gad.1917310. Epub 2010 Jun 15. PubMed PMID: 20551165; PubMed Central PMCID: PMC2895196.
  • 11: Milet C, Rincheval-Arnold A, Mignotte B, Guénal I. The Drosophila retinoblastoma protein induces apoptosis in proliferating but not in post-mitotic cells. Cell Cycle. 2010 Jan 1;9(1):97-103. Epub 2010 Jan 5. PubMed PMID: 20016284.
  • 12: DiAngelo JR, Birnbaum MJ. Regulation of fat cell mass by insulin in Drosophila melanogaster. Mol Cell Biol. 2009 Dec;29(24):6341-52. doi: 10.1128/MCB.00675-09. Epub 2009 Oct 12. PubMed PMID: 19822665; PubMed Central PMCID: PMC2786867.
  • 13: Stasiv Y, Kuzin B, Regulski M, Tully T, Enikolopov G. Regulation of multimers via truncated isoforms: a novel mechanism to control nitric-oxide signaling. Genes Dev. 2004 Aug 1;18(15):1812-23. Epub 2004 Jul 15. PubMed PMID: 15256486; PubMed Central PMCID: PMC517402.
  • 14: Kuzin B, Regulski M, Stasiv Y, Scheinker V, Tully T, Enikolopov G. Nitric oxide interacts with the retinoblastoma pathway to control eye development in Drosophila. Curr Biol. 2000 Apr 20;10(8):459-62. PubMed PMID: 10801421.
  • 15: Du W. Suppression of the rbf null mutants by a de2f1 allele that lacks transactivation domain. Development. 2000 Jan;127(2):367-79. PubMed PMID: 10603353.
  • 16: Dougan S, DiNardo S. Drosophila wingless generates cell type diversity among engrailed expressing cells. Nature. 1992 Nov 26;360(6402):347-50. PubMed PMID: 1280330.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Drosophila RBf1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below







    Cart (0 Items)

    Your cart is currently empty.

    View Products