Size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Escherichia coli (E. coli)
Applications	Elisa, WB

Cancer Chromatin and nuclear signaling Developmental Biology

Product name	Human Galectin3 (GAL3) recombinant protein
Uniprot ID	P17931
Uniprot link	http://www.uniprot.org/uniprot/P17931
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMILEHHHHHH
Molecular weight	27.17kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	50 mM Tris-HCl pH 8, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Full-length
Aliases /Synonyms	LGALS3, CBP35, GALBP, GALIG, MAC2, 35 kDa lectin, Carbohydrate-binding protein 35, Galactose-specific lectin 3, Galactoside-binding protein, Laminin-binding protein, Lectin L-29
Reference	PX-P4050
Note	For research use only

Description of Human Galectin3 (GAL3) recombinant protein

General Information about Human Galectin3 (GAL3) recombinant protein

Galectin-3 is a member of the animal lecithin family that binds selectively to β-galactoside residues. The protein is secreted from the cell by exocytosis, which is not related to the classic secretion pathway through the endoplasmic reticulum / Golgi network. Galectin-3 is related to the inhibition of apoptosis and the development of cancer. It is usually distributed in epithelial cells of various organs, several inflammatory cells (including macrophages), dendritic cells and Kupffer cells. The expression of this lectin is regulated during inflammation, cell proliferation, cell differentiation and transactivation of viral proteins. The recombinant Galectin-3 protein was expressed in E. coli and purified by conventional chromatography techniques.

Datasheet Download

MSDS Download

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human Galectin3 (GAL3) recombinant protein”

Price and Availability

Size

Clear

GET A QUOTE NOW

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Galegenimab Biosimilar – Anti-HTRA mAb – Research Grade

PX-TA1771 476$

View product

Polyclonal Antibody

GAL3ST1 Polyclonal Polyclonal Antibody

PTX18572 309$