Product name	Tumor necrosis factor receptor superfamily member 19L(Relt)
Uniprot ID	Q8BX43
Uniprot link	https://www.uniprot.org/uniprot/Q8BX43
Expression system	Eukaryotic expression
Sequence	MSLQGLMMKRTLLCWPLSCLFVLLPWPLATPTPITPWLCPPGKEPDPDPGQGTLCRTCPPGTFSASWNSYPCQPHYRCSLQKRLEAQAGTATHDTMCGDCQHGWFGPQGVPHVPCQPCSKAPPSTGGCDESGRGGGRGVEVAAGTSSNGEPRQPGNGTRAGGPEETAMVRSPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKHHHHHH
Molecular weight	41.56kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH 7.5.
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Met1-Ala167(Arg134Gly,Arg136Gly)
Protein Accession	Q8BX43
Spec:Entrez GeneID	320100
Spec:NCBI Gene Aliases	Tnfrs; Tnfrsf19l; E430021K24Rik
Spec:SwissProtID	Q497Z8
NCBI Reference	Q8BX43
Aliases /Synonyms	Tnfrsf19l
Reference	PX-P4750
Note	For research use only

No Products found