Product name	Glucose-6-phosphate exchanger SLC37A4 (in Insect)
Uniprot ID	O43826
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALCGSHHHHHH
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>85% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Applications	ELISA,WB
Fragment Type	Met1-Cys176
Aliases /Synonyms	Glucose-5-phosphate transporter,Glucose-6-phosphate translocase,Solute carrier family 37 member 4,Transformation-related gene 19 protein,TRG-19,G6PT, G6PT1
Reference	PX-P4611
Note	For research use only

No Products found