Brand: ProteoGenix

Anti-Bovine CYCS/CYC Antibody (SAA1419)

ARO-A15355-50
Quality Chart

Original price was: $427.00.Current price is: $324.00.

50ug 24% OFF + 324 loyalty points

Size Size

50ug Original price was: $427.00.Current price is: $324.00.
100ug Original price was: $614.00.Current price is: $462.00.
1MG Original price was: $1,714.00.Current price is: $1,339.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Anti-Bovine CYCS/CYC Antibody (SAA1419)

Datasheet

Anti-Bovine CYCS/CYC Antibody (SAA1419)

Product name	ARO-A15355-100
Uniprot ID	P62894
Raw Antigen Sequence	MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Bovine
Reference	ARO-A15355
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CYCS/CYC
Clone Name	SAA1419
Protein Name	CYCS/CYC
Target species	Anti-Bovine Monoclonal Antibody

Product name	ARO-A15355-1MG
Uniprot ID	P62894
Raw Antigen Sequence	MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Bovine
Reference	ARO-A15355
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CYCS/CYC
Clone Name	SAA1419
Protein Name	CYCS/CYC
Target species	Anti-Bovine Monoclonal Antibody

Product name	ARO-A15355-50
Uniprot ID	P62894
Raw Antigen Sequence	MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Bovine
Reference	ARO-A15355
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	CYCS/CYC
Clone Name	SAA1419
Protein Name	CYCS/CYC
Target species	Anti-Bovine Monoclonal Antibody

Datasheet

SDS-PAGE for Anti-Bovine CYCS/CYC Antibody (SAA1419)

Anti-Bovine CYCS/CYC Antibody (SAA1419), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Bovine CYCS/CYC Antibody (SAA1419)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Bovine CYCS/CYC Antibody (SAA1419)

Anti-Bovine CYCS/CYC Antibody (SAA1419)

SDS-PAGE for Anti-Bovine CYCS/CYC Antibody (SAA1419)

Related products

Rat IgG2a, kappa Isotype Control Antibody (RTK2758), PerCP

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Bovine CYCS/CYC Antibody (SAA1419)

Specifications Anti-Bovine CYCS/CYC Antibody (SAA1419)

Documents

QC & Validation

SDS-PAGE for Anti-Bovine CYCS/CYC Antibody (SAA1419)

3D Representation

Reviews

Related products

Rat IgG2a, kappa Isotype Control Antibody (RTK2758), PerCP

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Bovine CYCS/CYC Antibody (SAA1419)